Publikationen (Lehrstuhl)

Ergebnisse exportiert:
Peschel, M., & Kihm, P.. (2019). Fachliche Kompetenz der Lernbegleitung in Lernwerkstätten. In R. Baar, Feindt, A., & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten: Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Lernen und Studieren in Lernwerkstätten., S. 84-95). Bad Heilbrunn: Klinkhardt.
Kihm, P., Peschel, M., & Diener, J.. (2019). Kinderfragen in der Lernwerkstatt. In R. Baar, Feindt, A., & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten: Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Lernen und Studieren in Lernwerkstätten., S. 109-120). Bad Heilbrunn: Klinkhardt.
Kelkel, M., & Peschel, M.. (2019). Lernwerkstätten und Schülerlabore – Unterschiedliche Konzepte, ein Verbund. Kooperation zwischen GOFEX und NanoBioLab im Rahmen des GOFEX-Projektpraktikums als Beispiel für kooperatives Lernen. In R. Baar, Feindt, A., & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten: Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Lernen und Studieren in Lernwerkstätten., S. 185-189). Bad Heilbrunn: Klinkhardt.
Peschel, M., & Kihm, P.. (2019). Naturwissenschaftliche Phänomene im Grundschullabor für Offenes Experimentieren (GOFEX) entdecken. In Zeitschrift "Erziehung und Wissenschaft im Saarland" des Landesverbandes der GEW im DGB (02/2019. Aufl., Bd. 65. Jahrgang , S. 14-15).
PDF icon Peschel, Kihm (2018). Naturwissenschaftliche Phänomen im Grundschullabor für Offenes Experimentieren entdecken..pdf (846.91 KB)
Peschel, M. (2018). Digitales Lernen vs. analoges Lernen – Digitale Bildung in einer analogen Welt oder: Bildung für eine Welt mit digitalen Medien. In Wozu brauchen wir digitale Medien? (Grundschule aktuell., Bd. 142, S. 12-15). Frankfurt am Main: Grunndschulverband. Abgerufen von
Kelkel, M., & Peschel, M.. (2018). Fachlichkeit in Lernwerkstätten. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (S. 15-34). Bad Heilbrunn: Klinkhardt.
Schirra, S., Peschel, M., & Scherer, N.. (2018). „kidi on tour“ – Mobile Learning und das Potenzial digitaler Geomedien zur Vermittlung digitaler Raum-Zeitlichkeit am Beispiel von GOFEX und kidipedia. In Jahrbuch Medienpädagogik 14. Der digitale Raum – Medienpädagogische Untersuchungen und Perspektiven (S. 157-175). Wiesbaden: Springer VS.
PDF icon Peschel, M., Schirra, S., Scherer, N. (2018). kidi on tour-Mobile Learning und das Potenzial digitaler Geomedien (...) (843.24 KB)
Schirra, S., & Peschel, M.. (2018). kidipedia. Digitale Medien pädagogisch sinnvoll im Unterricht einsetzen.. In EuWiS. Zeitung ‚Erziehung und Wissenschaft im Saarland’ des Landesverbandes der GEW im DGB (S. 13-14). Abgerufen von
PDF icon kidipedia. Digitale Medien pädagogisch sinnvoll im Unterricht einsetzen. (8.91 MB)
Kihm, P., Diener, J., & Peschel, M.. (2018). Kinder forschen – Wege zur (gemeinsamen) Erkenntnis. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten. (Lernen und Studieren in Lernwerkstätten., S. 66-84). Bad Heilbrunn: Klinkhardt.
PDF icon kleines3x3zuSmartKids.pdf (2.54 MB)
Huwer, J., Lauer, L., Seibert, J., Thyssen, C., Dörrenbächer-Ulrich, L., & Perels, F.. (2018). Re-Experiencing Chemistry with Augmented Reality: New Possibilities for Individual Support. In World Journal of Chemical Education (5. Aufl., Bd. 6, S. 212-217). doi:10.12691/wjce-6-5-2
ValiZadeh, M., & Peschel, M.. (2018). SelfPro – Entwicklung von Selbstkonzepten beim Offenen Experimentieren. In U. Franz, Giest, H., Hartinger, A., Heinrich-Dönges, A., & Reinhoffer, B. (Hrsg.), Handeln im Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 28, S. 183-190). Bad Heilbrunn: Klinkhardt.
PDF icon Dissertation_Sarah Bach-komprimiert.pdf (8.71 MB)
Peschel, M., & Kelkel, M.. (2018). Zur Sache!. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (S. 9-14). Bad Heilbrunn: Klinkhardt.
Peschel, M., Kihm, P., Scherer, N., & Kelkel, M.. (2017). Einstellungen zum Experimentieren im Lehramt Primarstufe. In LeLa Magazin (17. Aufl., Bd. März 2017, S. 12-13).
PDF icon Peschel, Kelkel, Kihm, Scherer (2017). Einstellungen zum Experimentieren im Lehramt Primarstufe..pdf (385.46 KB)
Carle, U., & Peschel, M.. (2017). Forschung für die Praxis – Plädoyer für schulpraktisch relevante Forschung. In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (Beiträge zur Reform der Grundschule., Bd. 143, S. 8-19). Frankfurt am Main: Grundschulverband e.V. Abgerufen von
Kihm, P., & Peschel, M.. (2017). Interaktion und Kommunikation beim Experimentieren von Kindern – Eine Untersuchung über interaktions- und kommunikationsförderliche Aufgabenformate. In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (Beiträge zur Reform der Grundschule., Bd. 143, S. 68-80). Frankfurt am Main: Grundschulverband e.V. Abgerufen von
Schirra, S., & Peschel, M.. (2017). Kinder kindgerecht an digitale Medien heranführen. In KiTa aktuell. Fachzeitschrift für Leitungen, Fachkräfte und Träger der Kindertagesbetreuung (Bd. 25, S. 112-114).
Peschel, M., & Lang, M.. (2017). Selbstkonzeptentwicklung durch Offenes Experimentieren. In GDSU-Journal 7 (S. S.65-77). GDSU.
PDF icon Peschel, Lang (2017). Selbstkonzeptentwicklung durch Offenes Experimentieren. (360.19 KB)
Peschel, M. (2017). SelfPro: Entwicklung von Professionsverständnissen und Selbstkonzepten angehender Lehrkräfte beim Offenen Experimentieren. In S. Miller, Holler-Nowitzki, B., Kottmann, B., Lesemann, S., Letmathe-Henkel, B., Meyer, N., u. a. (Hrsg.), Profession und Disziplin - Grundschulpädagogik im Diskurs (Jahrbuch Grundschulforschung., Bd. 22, S. 191-196). Wiesbaden: Springer VS. Abgerufen von
PDF icon Peschel (2017). SelfPro.Entwicklung von Professionsverständnissen und Selbstkonzepten angehender Lehrkräfte beim Offen Experimentieren.pdf (282.7 KB)
Schirra, S., & Peschel, M.. (2017). Von Kids für Kids: Lernplattform kidipedia. Mediale und geografische Kompetenzen fördern. In Grundschulunterricht. Sachunterricht (Bd. 02/2017, S. 17-20).
PDF icon Weber, A. (2016). Ein Baum - Lebewesen und Lebensraum.pdf (547.12 KB)
Peschel, M. (2016). Energie als Perspektivenvernetzender Themenbereich im Sachunterricht. In C. Maurer (Hrsg.), Authentizität und Lernen - das Fach in der Fachdidaktik (Gesellschaft für Didaktik der Chemie und Physik., S. 373-375). Universität Regensburg.
PDF icon Peschel, M. (2016). Energie als Perspektivenvernetzender Themenbereich im Sachunterricht (597.17 KB)
Peschel, M. (2016). Entwicklung der selbst eingeschätzten Kompetenzen in der Sachunterrichtsausbildung im Saarland. In H. Giest, Goll, T., & Hartinger, A. (Hrsg.), Sachunterricht – zwischen Kompetenzorientierung, Persönlichkeitsentwicklung, Lebenswelt und Fachbezug (Probleme und Perspektiven des Sachunterrichts., Bd. 26, S. 149-157). Bad Heilbrunn: Klinkhardt.
Diehl, A., & Peschel, M.. (2016). (Erneuerbare) Energie im Grundschullabor für Offenes Experimentieren. In C. Maurer (Hrsg.), Authentizität und Lernen - das Fach in der Fachdidaktik (Gesellschaft für Didaktik der Chemie und Physik., Bd. 36, S. 515-517). Universität Regensburg.
PDF icon Peschel, M. & Diehl, A. (2016). (Erneuerbare) Energie im Grundschullabor für Offenes Experimentieren (563 KB)
Kelkel, M., Peschel, M., & Urig, N.. (2016). GOFEX_EE - Erneuerbare Energien im praktischen Test. LeLa BNE Broschüre "Bildung für nachhaltige Entwicklung in Schülerlaboren", 62-65. Abgerufen von
Irion, T., & Peschel, M.. (2016). Grundschule und neue Medien - Neue Entwicklungen. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 11-15). Grundschulverband.
Peschel, M. (2016). Inklusive Mediendidaktik in der Grundschule. In G. Erziehung Wissenschaft (Hrsg.), Erfolgreich mit Neuen Medien! - Was bringt das Lernen im Netz? (S. 33-36). Frankfurt a.M.: GEW. Abgerufen von
PDF icon 2016_Peschel_Inklusive Mediendidaktik in der Grundschule.pdf (646.26 KB)
Peschel, M., Schirra, S., & Carell, S.. (2016). kidipedia - Ein Unterrichtsvorschlag. In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (Dimensionen des Sachunterricht - Kinder.Sachen.Welten., Bd. 7, S. 65-78). Baltmannsweiler: Schneider-Verlag Hohengehren. Abgerufen von
PDF icon Peschel (2016). Lernkulturen in der Grundschule und im Sachunterricht.pdf (414.61 KB)
Peschel, M. (Hrsg.). (2016). Mediales Lernen – Beispiele für eine inklusive Mediendidaktik. Baltmannsweiler: Schneider-Verlag Hohengehren. Abgerufen von
Peschel, M. (2016). Mediales Lernen - Eine Modellierung als Einleitung. In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (Dimensionen des Sachunterricht - Kinder.Sachen.Welten., Bd. 7, S. 7-16). Baltmannsweiler: Schneider-Verlag Hohengehren. Abgerufen von
Peschel, M. (2016). Medienlernen im Sachunterricht - Lernen mit Medien und Lernen über Medien. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 33-49). Frankfurt a.M.: Grundschulverband.
Peschel, M. (2016). Neue Medien in der Grundschule 3.0. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 189-192). Grundschulverband.
Peschel, M. (2016). Offenes Experimentieren – Individuelles Lernen: Aufgaben in Lernwerkstätten. In H. Hahn, Esslinger-Hinz, I., & Panagiotopoulou, A. (Hrsg.), Paradigmen und Paradigmenwechsel in der Grundschulpädagogik (S. S. 120-131). Baltmannsweiler: Schneider-Verlag Hohengehren.
PDF icon Peschel (2016) Offenes Experimentieren – individuelles Lernen.pdf (7.26 MB)
Schirra, S., & Peschel, M.. (2016). Recherchieren, Dokumentieren und Präsentieren mit kidipedia im Zeitalter von Tablets & Co. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 235-246). Frankfurt a.M.: Grundschulverband.
Schirra, S., & Peschel, M.. (2016). Was geht? Neue Medien im Sachunterricht. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 309-315). Frankfurt a.M.: Grundschulverband.
Kihm, P., Knopf, J., & Ladel, S.. (2015). „Cu l8er – Cu2 :-)" – Was Kinder aus der SMS-Kommunikation lernen können.. In Grundschulunterricht Mathematik (Bd. 01, S. 19-22). Oldenbourg Schulbuchverlag.
Carell, S., & Peschel, M.. (2015). Einfluss des Onlinelexikons kidipedia auf die Naturwissenschaftskompetenz von Jungen und Mädchen an Schweizer Primschulen. In D. Blömer, Lichtblau, M., Jüttner, A. - K., Koch, K., Krüger, M., & Werning, R. (Hrsg.), Perspektiven auf inklusive Bildung – Gemeinsam anders lehren und lernen (Jahrbuch Grundschulforschung., Bd. 18, S. 216-223). Wiesbaden: Springer VS. Abgerufen von
PDF icon Carell, Peschel (2015). Einfluss des Onlinelexikons kidipedia...pdf (662.42 KB)
Diehl, A., & Peschel, M.. (2015). GOFEX - Erneuerbare Energien. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung - Festschrift, 43. Abgerufen von
PDF icon Schirra, Warken, Peschel (2015). kidipedia-Einsatz eines (audio-)visuellen Bildungsmediums im geographisch-orientierten Sachunterricht.pdf (3.27 MB)
Peschel, M. (2015). Konzeption des Grundschullabors für Offenes Experimentieren (GOFEX) - Elemente der Öffnung. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung - Festschrift, 122-123. Abgerufen von
Peschel, M., & Meiers, K.. (2015). Lesen im Sachunterricht. In Sache Wort Zahl. Lehren und Lernen in der Grundschule, Heft Nr. 150-151/43. Jahrgang Juni 2015 (S. 60-69). Hallbergmoos: Aulis.
Peschel, M. (2015). Medienerziehung im Sachunterricht. In J. Kahlert, Fölling-Albers, M., Götz, M., Miller, S., & Wittkowske, S. (Hrsg.), Handbuch Didaktik des Sachunterrichts. (S. 173-179). Bad Heilbrunn: Klinkhardt. Abgerufen von
Peschel, M. (2015). Offenes Experimentieren - das Projekt SelfPro. In H. - J. Fischer, Giest, H., & Michalik, K. (Hrsg.), Bildung im und durch Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 25, S. 59-64). Bad Heilbrunn: Klinkhardt. Abgerufen von
Lang, M., & Peschel, M.. (2015). SINUS trifft GOFEX. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung - Festschrift, 79. Abgerufen von
Peschel, M. (2014). Außerschulische Lernorte in der Sachunterrichtsausbildung. In D. Brovelli, Fuchs, K., Rempfler, A., & Häller, B. Sommer (Hrsg.), Ausserschulische Lernorte – Impulse aus der Praxis (S. 131-136). Berlin: LIT.
Fischer, H. - J., Giest, H., & Peschel, M.. (2014). Editional. In H. - J. Fischer, Giest, H., & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 24, S. 9-16). Bad Heilbrunn: Klinkhardt.
Giest, H., & Peschel, M.. (2014). Editional. In H. Giest & Peschel, M. (Hrsg.), GDSU-Journal (Bd. 4, S. 7-8). GDSU. Abgerufen von
Peschel, M. (2014). Individuelle Förderung beim naturwissenschaftlichen Lernen im Sachunterricht der Grundschule. In (Zeitschrift für Grundschulforschung., Bd. 2-2014, S. 146-160). Bad Heilbrunn: Klinkhardt.
Carell, S., & Peschel, M.. (2014). kidipedia – Ergebnisse eines Forschungsprojektes im Sachunterricht. In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (Bd. 34, S. 489-491). Kiel: IPN. Abgerufen von
PDF icon Peschel, Carell (2014). kidipedia - Ergebnisse eines Forschungsprojekts im Sachunterricht.pdf (1.34 MB)
Peschel, M., & Koch, A.. (2014). Lehrertypen – Typisch Lehrer?! Clusterungen im Projekt SUN. In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (Bd. 34, S. 216-218). Kiel: IPN. Abgerufen von
PDF icon Peschel, Koch (2014). Lehrertypen-Typisch Lehrer? Clusterungen im Projekt SUN (1.27 MB)
Hildebrandt, E., Peschel, M., & Weißhaupt, M.. (2014). Lernen zwischen freiem und instruiertem Tätigsein – Eine Einführung. In E. Hildebrandt, Peschel, M., & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (1. Aufl., S. 9-13). Bad Heilbrunn: Klinkhardt. Abgerufen von
Peschel, M. (2014). Medienerziehung. In A. Hartinger & Lange, K. (Hrsg.), Sachunterricht – Didaktik für die Grundschule (S. 158-169). Berlin: Cornelsen Scriptor. Abgerufen von
Carell, S., & Peschel, M.. (2014). Motivations- und Interessenveränderungen bei der Arbeit mit In H. - J. Fischer, Giest, H., & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 24, S. 79-86). Bad Heilbrunn: Klinkhardt.
Peschel, M. (2014). Vom instruierten zum Freien Forschen – Selbstbestimmungskonzepte im GOFEX. In E. Hildebrandt, Peschel, M., & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (Lernen & Studieren in Lernwerkstätten - Impulse für Theorie und Praxis einer innovativen Lehrerbildung., Bd. 1, S. 67-79). Bad Heilbrunn: Klinkhardt.
PDF icon Peschel (2014) Selbstbestimmung im GOFEX.pdf (109.44 KB)
PDF icon Wegweiser WiSe 2014/15 (735.13 KB)
Peschel, M., Favre, P., & Mathis, C.. (2013). Einleitung. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten - Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Dimensionen des Sachunterrichts - Kinder.Sachen.Welten., S. 5-6). Baltmannsweiler: Schneider-Verlag.
Peschel, M., & Carell, S.. (2013). Entwicklungen in der Medienpädagogik von Mosaik (1992/1993) zu kidipedia (2012) – zukunftsfähige Konzeption für den Sachunterricht?. In H. - J. Fischer, Giest, H., & Pech, D. (Hrsg.), Der Sachunterricht und seine Didaktik – Bestände prüfen und Perspektiven entwickeln (Bd. 23, S. 121-128). Bad Heilbrunn: Klinkhardt (= Probleme und Perspektiven des Sachunterrichts. 23).
Schumacher, A., & Peschel, M.. (2013). Forschendes Lernen im Grundschullabor für Offenes Experimentieren (GOFEX). In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (S. 545-547). Kiel: IPN. Abgerufen von
PDF icon Peschel, Schumacher (2013). Forschendes Lernen im Grundschullabor für Offenes Experimentieren .pdf (919.59 KB)
Carell, S., & Peschel, M.. (2013). Forschendes Lernen im Web 2.0 - kidipedia. In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik (Bd. 33, S. 560–562). Kiel: IPN. Abgerufen von
PDF icon Peschel, Carell (2013). Forschendes Lernen im Web 2.0 - kidipedia.pdf (785.23 KB)
Peschel, M., Köster, H., & Zimmermann, M.. (2013). Forschendes Lernen in der Frühpädagogik und im Sachunterricht. In S. Bernhold (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (S. 542-544). Kiel: IPN. Abgerufen von
PDF icon Peschel, Köster, Zimmermann (2013). Forschendes Lernen in der Frühpädagogik und im Sachunterricht.pdf (693.6 KB)
Peschel, M. (2013). GOFEX – Ort des Lehrens und Lernens. In E. Wannack, Bosshart, S., Eichenberger, A., Fuchs, M., Hardegger, E., & Marti, S. (Hrsg.), 4-12-jährige – Ihre schulischen und außerschulischen Lern- und Lebenswelten (S. 260-268). Münster, New York, München, Berlin: Waxmann.
PDF icon Peschel, M. (2013) GOFEX - Ort des Lehrens und Lernens.pdf (1.81 MB)
Peschel, M. (2013). Gute Aufgaben für forschendes Lernen im experimentierenden Sachunterricht. In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung Hannover 2012 (Bd. 33, S. 128–130). Kiel: IPN. Abgerufen von
PDF icon Peschel (2013). Gute Aufgaben für Forschendes Lernen im experimentierenden Sachunterricht.pdf (697.91 KB)
Gervé, F., & Peschel, M.. (2013). Medien im Sachunterricht. In E. Gläser & Schönknecht, G. (Hrsg.), Sachunterricht in der Grundschule (S. 58-79). Arbeitskreis Grundschule – Der Grundschulverband.
Peschel, M. (2013). Perspektivenvernetzender Themenbereich Medien. In Perspektivrahmen Sachunterricht (S. 83–85). Bad Heilbrunn: Klinkhardt.
Schröder, C.. (2013). Politische Umbrüche und Soziale Arbeit in der Maghreb-Maschrek-Region. In Weltatlas Sozialen Arbeit - Jenseits aller Vermessungen (S. 32-51). Weinheim; Basel: Beltz Juventa.
Schröder, C.. (2013). Quién define lo que es el FSM? . In (Foro Social Mundial: ¿Momento de replanteamientos?).
PDF icon Online verfügbar unter (861.14 KB)
Peschel, M., Favre, P., & Mathis, C.. (2013). Sachunterricht im Wandel. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten - Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Bd. Dimensionen des Sachunterrichts - Kinder.Sachen.Welten, S. 7-20). Baltmannsweiler: Schneider-Verlag.
Mathis, C., & Peschel, M.. (2013). Sachunterrichtsstudium für die Vorschul- /Primarstufe an der Pädagogischen Hochschule FHNW. In M. Peschel, Favre, P., & Mathis, C. (Hrsg.), SaCHen unterriCHten - Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Dimensionen des Sachunterrichts - Kinder.Sachen.Welten., S. 67-82). Baltmannsweiler: Schneider-Verlag.
Czepukojc, B., Baltes, A. - K., Cerella, C., Kelkel, M., Viswanathan, U. Maheswari, Salm, F., u. a.. (2013). Synthetic polysulfane derivatives induce cell cycle arrest and apoptotic cell death in human hematopoietic cancer cells. In Food and chemical toxicology: an international journal published for the British Industrial Biological Research Association 64.
PDF icon Synthetic polysulfane derivatives induce cell cycle arrest and apoptotic cell death in human hematopoietic cancer cells (1.23 MB)
Schröder, C., & Homfeldt, H. Günther. (2013). Transnationales Wissen in NGOs. In Transnationales Wissen und Soziale Arbeit. Weinheim; Basel: Beltz Juventa.
Peschel, M. (2013). Vergleichen und Recherchieren. In (Hrsg.), Perspektivrahmen Sachunterricht (S. 148–152). Bad Heilbrunn: Klinkhardt.
Schröder, C.. (2013). Who defines what the World Social Forum is?. In (Foro Social Mundial: ¿Momento de replanteamientos?).
PDF icon Online verfügbar unter (128.25 KB)
PDF icon Peschel (2012) Geldautomat.PDF (624.31 KB)
PDF icon Peschel, Carell (2012). Die Internetplattform kidipedia im Unterricht sinnvoll nutzen.pdf (136.3 KB)
Peschel, M. (2012). Gute Aufgaben im Sachunterricht - Offene Werkstätten = Gute Aufgaben?. In U. carle & Kosinar, J. (Hrsg.), Aufgabenqualität in der Grundschule (S. 161-172). Baltmannsweiler: Schneider-Verlag Hohengehren.
PDF icon Peschel, M. (2012) Gute Aufgaben im Sachunterricht.pdf (1.84 MB)
Peschel, M., & Carell, S.. (2012). Kidipedia - Unterstützungsangebot für Mädchen & Jungen im Sachunterricht. In S. Bernholt (Hrsg.), Konzepte fachdidaktischer Strukturierung für den Unterricht (Bd. 32, S. S. 464-467). Berlin : LIT.
PDF icon Peschel (2012). Mediendidaktik, Medienkompetenz, Medienerziehung - Web 2.0 Aktivitäten im Sachunterricht.pdf (86.21 KB)
Peschel, M., & Schumacher, A.. (2012). Neue Wege beim Experimentieren. Schulblatt der Kantone Aargau und Solothurn.
Peschel, M., & Streit, C.. (2012). Physik und Mathe können lustvoll gelernt werden. Bildungsseite der Aargauer Zeitung und der Basler Zeitung.
PDF icon Kelkel, Cerella, Mack, Schneider, Jacob, Schumacher, Diacto, Diederich (2012). ROS-independent JNK activation and multisite phosphorylation of Bcl-2 link diallyl tetrasulfide-induced mitotic arrest to apoptosis.pdf (2.44 MB)
Kelkel, M., Schumacher, M., Dicato, M., & Diederich, M.. (2011). Antioxidant and anti-proliferative properties of lycopene. In Free Radical Research (8. Aufl., Bd. 45, S. 925-940). doi: 10.3109/10715762.2011.564168
PDF icon Kelkel, Schumacher, Dicato, Diederich (2011). Antioxidant and anti-proliferative properties of lycopene.pdf (447.21 KB)
Peschel, M. (2011). Der Lernstick und die Schulfächer – Versuch einer Übersicht. In H. - U. Grunder (Hrsg.), mLearning in der Schule (S. 51-72). Baltmannsweiler: Schneider-Verlag Hohengehren.
PDF icon Schumacher, Kelkel, Dicato, Diederich (2011).Gold from the sea: Marine compounds as inhibitors of the hallmarks of cancer.pdf (1.92 MB)
Peschel, M. (2011). kidipedia – Ein Onlinelexikon von Kids für Kids. In H. Giest, Kaiser, A., & Schomaker, C. (Hrsg.), Sachunterricht - auf dem Weg zur Inklusion (Probleme und Perspektiven des Sachunterrichts., Bd. 21, S. 193-198). Bad Heilbrunn: Klinkhardt.
PDF icon Peschel (2011). kidipedia - Ein Onlinelexikon von Kids für Kids.pdf (373.11 KB)
Peschel, M., & Streit, C.. (2011). Lern-Atelier in Solothurn eröffnet. Schulblatt der Kantone Aargau und Solothurn.
Peschel, M. (Hrsg.). (2011). Macht der Mond die Nacht? - Tag und Nacht im Kindergarten. In Weltwissen Sachunterricht (Bd. Heft 03/2011, S. 6-7). Westermann-Verlag. Abgerufen von
PDF icon Peschel, M.(2011). Macht der Mond die Nacht? (1.09 MB)
Peschel, M. (2011). Medienerziehung und schulische Sozialerziehung. In M. Limbourg & Steins, G. (Hrsg.), Sozialerziehung in der Schule (S. 451-474). VS-Verlag.
Schröder, C.. (2011). “Mit vereinten Kräften voran”. Social Development in einem Kooperationsprojekt einer transnationaeln NGO und einer loken NGO. In Soziale Arbeit als Entwicklungszusammenarbeit. Baltmannsweiler: Schneider Hohengehren.
PDF icon Cerella, Kelkel, Viry, Dicato, Jacob, Diederich (2011). Naturally Occurring Organic Sulfur Compounds: An Example of a Multitasking Class of Phytochemicals in Anti-Cancer Research..pdf (711.62 KB)
PDF icon Online verfügbar unter (398.73 KB)
Schneider, T., Baldauf, A., Schneider, M., Burkholz, T., Kelkel, M., & Jacob, C.. (2011). Selective Antimicrobial Activity Associated with Sulfur Nanoparticles. In Journal of Biomedical Nanotechnology (3. Aufl., Bd. 7, S. 395405). doi:10.1166/jbn.2011.1293
PDF icon Schneider et al. (2011).Selective Antimicrobial Activity Associated with Sulfur Nanoparticles.pdf (1.28 MB)
PDF icon Schumacher, Kelkel, Dicato, Diederich (2011). A Survey of Marine Natural Compounds and Their Derivatives with Anti-Cancer Activity Reported in 2010.pdf (2.1 MB)
Peschel, M. (2011). Wege zum Offenen Experimentieren. (K. Scheler, Hrsg.)Wissenschaft trifft Praxis - Bericht von der Expertentagung zur frühen naturwissenschaftlichen Bildung, (Forscherstation - Heidelberg), 48-54.
Peschel, M., & Struzyna, S.. (2010). Das Raumkonzept des Grundschullabors zum Offenen Experimentieren als Element der Öffnung. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 458-460). Berln: LIT. Abgerufen von
PDF icon PeschelStruzyna (2010) GOFEX - Der Raum als Element der Öffnung.pdf (4.36 MB)
PDF icon Decrypting the labyrinth of inflammatory cell signaling pathways.pdf (67.68 KB)
Peschel, M., Weißer, P., & Schäfer, J.. (2010). Der Zucker nimmt die Tinte Huckepack. – Kooperationen zwischen Schule und Universität. In Sache – Wort – Zahl (SWZ) (Heft 112, 09/2010, 38. Jhg., S. 48-56). Aulis Verlag.
PDF icon Peschel (2010) Der Zucker nimmt die Tinte Huckepack.PDF (1.55 MB)
Peschel, M., & Carell, S.. (2010). Die Materialsammlung im Grundschullabor für Offenes Experimentieren. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 461-463). Berlin: LIT. Abgerufen von
PDF icon PeschelCarell (2010) Das Materialkonzept.pdf (5.36 MB)
Peschel, M., & Struzyna, S.. (2010). GOFEX - Grundschullabor für Offenes Experimentieren: Entwicklung eines Raumkonzeptes als Element der Öffnung. In K. - H. Arnold, Hauenschild, K., Schmidt, B., & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung ((Jahrbuch Grundschulforschung., Bd. 14, S. 197-200). Wiesbaden: VS-Verlag.
PDF icon Peschel, M., Struzyna, S. (2010). GOFEX : Entwicklung eines Raumkonzeptes als Element der Öffnung (1.52 MB)
Peschel, M. (2010). Grundschullabor für Offenes Experimentieren – Grundschultransfer?. In H. Giest & Pech, D. (Hrsg.), Anschlussfähige Bildung im Sachunterricht (Probleme und Perspektiven des Sachunterrichts., Bd. 20, S. 49-57). Heilbrunn: Klinkhardt.
PDF icon Peschel. M. (2010) GOFEX - Grundschultransfer?.pdf (9.28 MB)
Peschel, M. (2010). kidipedia – Präsentieren von Sachunterrichtsergebnissen im Internet. In M. Peschel (Hrsg.), Neue Medien im Sachunterricht (S. 71-78). Baltmannsweiler: Schneider-Verlag Hohengehren.
PDF icon Peschel (2010) kidipedia - Präsentieren von Sachunterrichtsergebnissen im Internet.pdf (706.07 KB)
Peschel, M. (2010). kidipedia – Untersuchung der Machbarkeit einer neuartigen Online-Plattform. Arbeitspapiere der Hans-Böckler-Stiftung (Bd. 190). Düsseldorf: Setzkasten. Abgerufen von
PDF icon Peschel (2010).kidipedia-Untersuchung der Machbarkeit einer neuartigen Onlineplattform .pdf (4.34 MB)
Peschel, M. (2010). – Eine Präsentationsplattform im Internet für Sachunterrichtsergebnisse. In K. - H. Arnold, Hauenschild, K., Schmidt, B., & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung (Jahrbuch Grundschulforschung., Bd. 14, S. 193-196). Wiesbaden: VS-Verlag.
Peschel, M. (2010). Luft und Vakuum. Experimente mit Luft..und ohne!. In Sache – Wort – Zahl (SWZ) (Bd. Heft 108, 03/2010, 38. Jhg., S. 23 - 25). Aulis Verlag.
PDF icon Peschel (2010) Luft und Vakuum.PDF (748.87 KB)
Peschel, M., & Herrmann, C.. (2010). Materialaspekt im Sachunterricht - Einflüsse des Materials auf die physikalischen Anteile des Sachunterrichts. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 455-457). Berlin: LIT. Abgerufen von
PDF icon Peschel (2010).Neue Medien in Forschung und Praxis. Ergebnisse aus der Arbeitsgruppe AG Neue Medien (ICT) im Sachunterricht GDSU.PDF (228.35 KB)
Peschel, M., & Carell, S.. (2010). Nutzungsweise computergestützter Medien – Unterschiede zwischen Jungen und Mädchen?!. In Neue Medien im Sachunterricht (S. 79-86). Baltmannsweiler: Schneider-Verlag Hohengehren.
PDF icon Kelkel, Jacob, Dicato, Diederich (2010).Potential of the Dietary Antioxidants Resveratrol and Curcumin in Prevention and Treatment of Hematologic Malignancies.pdf (792.79 KB)
Peschel, M. (2009). Alleine geht es gut, zusammen manchmal besser! – Kooperationen im Sachunterricht beim Experimentieren. In Sache – Wort – Zahl (SWZ) (Bd. Heft 101, 04/2009, 37 Jhg., S. 23-27). Aulis Verlag.
PDF icon Peschel, M. (2009). Alleine geht es gut, zusammen manchmal besser!.pdf (7.55 MB)
Peschel, M. (2009). Aus- und Fortbildungen für den naturwissenschaftlich-physikalischen Sachunterricht. In R. Lauterbach, Giest, H., & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (Bd. 19, Probleme und Perspektiven des Sachunterrichts, S. 149-156). Bad Heilbrunn: Klinkhardt.
Peschel, M. (2009). Der Begriff der Offenheit beim Offenen Experimentieren. In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 268-270). Berlin: LIT.
PDF icon Peschel (2009) Der Begriff der Offenheit beim Offenen Experimentieren.pdf (3.82 MB)
Peschel, M. (2009). GOFEX – Grundschullabor für Offenes Experimentieren. Grundlegende Konzeption. In R. Lauterbach, Giest, H., & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (Bd. 19, Probleme und Perspektiven des Sachunterrichts, S. 229-236). Bad Heilbrunn: Klinkhardt.
PDF icon Peschel (2009) GOFEX. Grundlegende Konzeption.pdf (528.97 KB)
Peschel, M. (2009). Naturwissenschaftliche Aus- und Fortbildung für den Sachunterricht – Ergebnisse aus dem Projekt SUN zum physikbezogenen Sachunterricht. In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 143-145). Berlin: LIT.
Peschel, M., & Giest, H.. (2009). Spielen am Computer - Chancen für den Sachunterricht. In Grundschulunterricht – Sachunterricht (Bd. 02/2009, S. 33-37). Oldenbourg-Verlag.
PDF icon Peschel, M., Giest, H. (2009). Spielen am Computer-Chancen für den Sachunterricht (989.62 KB)
Peschel, M., & Bürger, C.. (2009). Unterrichtsbedingungen für physikalischen Sachunterricht (SUN). In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 428-430). Berlin: LIT.
Peschel, M. (2008). GOFEX – Grundschullabor für Offenes Experimentieren. In Didaktik der Physik. Regensburg, Berlin: Lehmanns Media -
Peschel, M. (2008). kidipedia - Ein Wikipedia für Kids. Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung - Empirische Lehr-Lern-Forschung, 70-72.
Peschel, M. (2008). Offenes Experimentieren – Eine Chance für Jungen und Mädchen!. In J. Ramsberger & Ramsberger, W. (Hrsg.), Chancengleichheit in der Grundschule. Ursachen und Wege aus der Krise (Bd. 12, Jahrbuch Grundschulforschung). Wiesbaden: VS Verlag für Sozialwissenschaften.
PDF icon Peschel, M. (2008) Offenes Experimentieren - Eine Chance für Jungen und Mädchen.pdf (88.68 KB)
Peschel, M. (2008). Schriftanlässe – Anlässe zum Schreiben. In Grundschule Deutsch (Bd. 02/2008). Oldenburg-Verlag.
PDF icon Peschel, M. (2008). Schriftanlässe. Kommunikation im Schriftspracherwerb..pdf (5.57 MB)
Peschel, M. (2008). SUN: Erhebung der Lehrvoraussetzungen und des Professionswissens von Lehrenden im Sachunterricht der Grundschule. Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung - Empirische Lehr-Lern-Forschung, 68-70.
Peschel, M. (2007). Konzeption einer Studie zu den Lehrvoraussetzungen und dem Professionswissen von Lehrenden im Sachunterricht der Grundschule in NRW. Das Projekt SUN. In R. Lauterbach, Hartinger, A., Feige, B., & Cech, D. (Hrsg.), Kompetenzerwerb im Sachunterricht fördern und erfassen (Bd. 17, Probleme und Perspektiven des Sachunterrichts, S. 151-160).
PDF icon Peschel,M. (2007). Konzeption einer Studie zu den Lehrvoraussetzungen und dem Professionswissen von Lehrenden im Sachunterricht der Grundschule in NRW. Das Projekt SUN..pdf (713.99 KB)
Peschel, M., & Struzyna, S.. (2007). Wer unterrichtet unsere Kinder? SUN – Sachunterricht in Nordrhein- Westfalen. In K. möller, Hanke, P., Beinbrech, C., Hein, A., Kleickmann, T., & Schages, R. (Hrsg.), Qualität von Grundschulunterricht entwickeln, erfassen und bewerten (Bd. 11, Jahrbuch Grundschulforschung, S. 171-174). Bonn: Verlag für Soialwissenschaften.
PDF icon Peschel, M., Struzyna, S. (2007). Wer unterrichtet unserer Kinder? (111.99 KB)
Peschel, M. (2006). Das Mobile Computerlabor. Konzeption und Anwendungen. In V. Nordmeier & Oberländer, A. (Hrsg.), Didaktik der Physik Kassel. Berlin: Lehmanns Media.
Peschel, M. (2006). Der Computer zur Präsentation von Experimenten im Sachunterricht. In Zeitschrift Grundschulunterricht (Bd. 05/2006, S. S. 31-34). Oldenburg-Verlag.
Peschel, M. (2006). LDS im Werkstattunterricht. Defintion und Abgrenzung. In R. Hinz & Pütz, T. (Hrsg.), Professionelles Handeln in der Grundschule (Entwicklungslinien der Grundschulpädagogik., Bd. 3, S. 159-166). Baltmannsweiler: Schneider-Verlag Hohengehren.
Peschel, M. (2006). Lehrvoraussetzungen und Professionswissen von Lehrenden im Sachunterricht der Grundschule. (A. Pitton, Hrsg.)Fachdidaktische Forschung - Empirische Lehr-Lern-Forschung. Essen, 88ff.
Peschel, M. (2006). Sachunterricht und Lautorientierter Schriftspracherwerb. In R. Hinz & Schumacher, B. (Hrsg.), Auf den Anfang kommt es an: Kompetenzen entwickeln - Kompetenzen stärken (S. S. 67-76). Wiesbaden: VS Verlag für Sozialwissenschaften. Abgerufen von
PDF icon Peschel (2006). Sachunterricht und Lautorientierter Schriftspracherwerb.pdf (150.25 KB)
Peschel, M. (2005). Lernchance Computer?. Tagungsband der Hans-Böckler-Stiftung.
Peschel, M. (2003). Die "Dichterlesung". Ein Element der schriftlichen Kommunikation beim Schriftspracherwerb mit "Lesen durch Schreiben". In A. Panagiotopoulou & Brügelmann, H. (Hrsg.), Grundschulpädagogik meets Kindheitsforschung. Zum Wechselverständnis von schulischem Lernen und außerschulischen Erfahrungen im Grundschulalter (Jahrbuch Grundschulforschung., S. 145-149).

Projekte im Fokus

Das Grundschullabor für Offenes Experimentieren (GOFEX, hat das Ziel, das...

Projekte im Fokus

GeAR – Gelingensbedingungen und Grundsatzfragen von Augmented Reality in experimentellen Lehr-...
Go to top