Publikationen (Lehrstuhl)


  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1373 von /var/www/vhosts/
  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1376 von /var/www/vhosts/
  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1379 von /var/www/vhosts/
  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1382 von /var/www/vhosts/
  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1373 von /var/www/vhosts/
  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1376 von /var/www/vhosts/
  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1379 von /var/www/vhosts/
  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1373 von /var/www/vhosts/
  • Notice: A non well formed numeric value encountered in csl_number->ordinal() (Zeile 1376 von /var/www/vhosts/
Peschel, M. , & Mammes, I. . (2022). Der Sachunterricht und die Didaktik des Sachunterrichts als besondere Herausforderung für die Professionalisierung von Grundschullehrkräften. In I. Mammes & Rotter, C. (Hrsg.), Professionalisierung von Grundschullehrkräften. Kontext, Bedingungen und Herausforderungen (S. 188-203). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (206.63 KB)
Haider, M. , Peschel, M. , Irion, T. , Gryl, I. , Schmeinck, D. , & Brämer, M.. (2022). Die Veränderung der Lebenswelt der Kinder und ihre Folgen für Sachunterricht, Lehrkräftebildung und sachunterrichtsdidaktische Forschung. In A. Becher, Blumberg, E. , Goll, T. , Michalik, K. , & Tenberge, C. (Hrsg.), Sachunterricht in der Informationsgesellschaft (Bd. 32, Probleme und Perspektiven des Sachunterrichts, S. 55-72). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (1.04 MB)
Peschel, M. . (2022). Digital literacy – Medienbildung im Sachunterricht. In J. Kahlert, Fölling-Albers, M. , Götz, M. , Hartinger, A. , Miller, S. , & Wittkowske, S. (Hrsg.), Handbuch Didaktik des Sachunterrichts (3. Aufl., S. 188-197). Bad Heilbrunn: Verlag Julius Klinkhardt.
Fischer, M. , & Peschel, M. . (2022). Fachliche Konzepte zum Thema „Schwimmen und Sinken“ im Sachunterricht. In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (Bd. 13, S. 53-56). Berlin: GDSU e. V.
 (956.12 KB)
Peschel, M. , Seibert, J. , & Lauer, L. . (2022). Fach-Mediales Lernen – Augmented Reality (AR) im Chemie- und Sachunterricht. In S. Habig (Hrsg.), Unsicherheit als Element von naturwissenschaftsbezogenen Bildungsprozessen. Gesellschaft für Didaktik der Chemie und Physik, Online-Jahrestagung 2021. Duisburg: Universität Duisburg-Essen. Abgerufen von
 (400.45 KB)
Kihm, P. , & Peschel, M. . (2022). Gute Aufgaben 2.0 – Aufgaben und Aufgabenkulturen im Rahmen der Digitalisierung. In A. Becher, Blumberg, E. , Goll, T. , Michalik, K. , & Tenberge, C. (Hrsg.), Sachunterricht in der Informationsgesellschaft (Bd. 32, Probleme und Perspektiven des Sachunterrichts, S. 89-95). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (855.79 KB)
Lauer, L. , & Peschel, M. . (2022). Inwiefern eignen sich Augmented Reality-Technologien für den Einsatz im Sachunterricht der Primarstufe?. In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (Bd. 13, S. 94-96). Berlin: GDSU e. V.
 (853.29 KB)
Fischer, M. , Kunz, C. , Liebig, M. , Weber, A. , & Peschel, M. . (2022). (Lebens-)Welt als Ausgangspunkt und Zieldimension des Sachunterrichts und des Anfangsunterrichts. In M. Gutzmann & Carle, U. (Hrsg.), Anfangsunterricht – Willkommen in der Schule! (Bd. 154, Beiträge zur Reform der Grundschule, S. 248-263). Frankfurt a. M.: Grundschulverband e. V.
Kelkel, M. , & Peschel, M. . (2022). Offline- vs. Online-Formate – Eine Gegenüberstellung verschiedener Formate GOFEX-Präsentationen. In " GDSU" (Hrsg.), GDSU-Journal, März 2022 (Bd. 13, S. 102-104). Berlin: GDSU e. V.
 (788.89 KB)
Lauer, L. , & Peschel, M. . (2022). Praxisideen für Augmented Reality (AR) im naturwissenschaftlich-orientierten Sachunterricht. In B. Brandt, Bröll, L. , & Dausend, H. (Hrsg.), Digitales Lernen in der Grundschule III. Fachdidaktiken in der Diskussion (S. 227-238). Münster: Waxmann Verlag.
 (1.95 MB)
Lauer, L. , Peschel, M. , Malone, S. , Altmeyer, K. , Brünken, R. , Javaheri, H. , u. a.. (2022). Real-time Visualization of Electrical Circuit Schematics: An Augmented Reality Experiment Setup to Foster Representational Knowledge in Introductory Physics Education. In J. Kuhn & Vogt, P. (Hrsg.), Smartphones as Mobile Minilabs in Physics. Edited Volume Featuring more than 70 Examples from 10 Years The Physics Teacher-column iPhysicsLabs (S. 335-340). Berlin: Springer Verlag.
Peschel, M. , Gryl, I. , Straube, P. , Bach, S. , Brämer, M. , & Kunkel, C.. (2022). Sachunterrichtliche Bildung in der digitalen Welt. Die digitale Transformation im Fokus der Didaktik des Sachunterrichts. In V. Frederking & Romeike, R. (Hrsg.), Fachliche Bildung in der digitalen Welt. Digitalisierung, Big Data und KI im Forschungsfokus von 15 Fachdidaktiken (Bd. 3, Allgemeine Fachdidaktik, S. 359-387). Münster: Waxmann Verlag.
Kihm, P. , & Peschel, M. . (2021). Aufgaben und Kulturen des Lernens. „Gute Aufgaben“ als (Ver-)Mittler einer Lehr-Lern-Kultur. In M. Peschel (Hrsg.), Didaktik der Lernkulturen (Bd. 153, Beiträge zur Reform der Grundschule, S. 79-103). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P. , & Peschel, M. . (2021). Aushandlung von Selbstbestimmung in Experimentier-Lehr-Lern-Situationen im Grundschullabor für Offenes Experimentieren (doing AGENCY). In Zentrum für Lehrerbildung (ZfL) Universität des Saarlandes. Newsletter (Bd. 2, S. 6-9). Saarbrücken: Universität des Saarlandes.
 (1.01 MB)
Peschel, M. . (2021). Das Fahrrad im Sachunterricht. Ein fachübergreifendes Thema für die Grundschule. In Radfahren (Bd. 29, Grundschule Sport, S. 23-25). Seelze: Friedrich Verlag. Abgerufen von
 (158.29 KB)
Lang, V. , Seibert, J. , Eichinger, A. , Bach, S. , Kelkel, M. , Peschel, M. , u. a. (2021). Das Projekt SCIENCE without FICTION innerhalb des Reality-Virtuality-Continuum. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 374-377). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von
 (984.32 KB)
Neuböck-Hubinger, B. , & Peschel, M.. (2021). Das Schulbuch im Sachunterricht. Notwendige Änderungen für die Zukunft eines vielperspektivischen Sachunterrichts. In Erziehung & Unterricht (171. Aufl., Bd. 7-8, S. 703-708). Wien: Österreichischer Bundesverlag Schulbuch.
Neuböck-Hubinger, B. , Peschel, M. , & Andersen, K.. (2021). Das Unterrichtsthema „Dinge im Wasser“ in österreichischen Schulbüchern des Sachunterrichts – empirische Ergebnisse. In " GDSU" (Hrsg.), GDSU-Journal, Juli 2021 (Bd. 12, S. 107-118). Berlin: GDSU e. V.
 (107.89 KB)
Peschel, M. . (2021). Demokratie und Digitalisierung im Sachunterricht. In T. Simon (Hrsg.), Demokratie im Sachunterricht – Sachunterricht in der Demokratie. Beiträge zum Verhältnis von Demokratie(lernen) und Sachunterricht(sdidaktik) (S. 131-145). Wiesbaden: Springer VS. doi:10.1007/978-3-658-33555-7_10
 (178.8 KB)
Kihm, P. , & Peschel, M. . (2021). Demokratielernen durch Experimentieren?! – Aushandlung eines selbstbestimmten Vorgehens beim Offenen Experimentieren im Sachunterricht. In T. Simon (Hrsg.), Demokratie im Sachunterricht – Sachunterricht in der Demokratie. Beiträge zum Verhältnis von Demokratie(lernen) und Sachunterricht(sdidaktik) (S. 197-207). Wiesbaden: Springer VS. doi:10.1007/978-3-658-33555-7_15
 (161.39 KB)
Peschel, M. . (2021). Didaktik der Lernkulturen. Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. , Fischer, M. , Kihm, P. , & Liebig, M. . (2021). Fragen der Kinder – Fragen der Schule – Fragen an die Sache. Die Kinder-Sachen-Welten-Frage (KSW-Frage) als Element einer neuen Lernkultur im Sinne der didaktischen Inszenierung eines vielperspektivischen Sachunterrichts. In M. Peschel (Hrsg.), Didaktik der Lernkulturen (Bd. 153, Beiträge zur Reform der Grundschule, S. 231-250). Frankfurt a. M.: Grundschulverband e. V.
Lauer, L. , & Peschel, M. . (2021). Gestaltung von Lehr-Lernumgebungen mit Augmented Reality (AR). In C. Maurer, Rincke, K. , & Hemmer, M. (Hrsg.), Fachliche Bildung und digitale Transformation – Fachdidaktische Forschung und Diskurse. Fachtagung der Gesellschaft für Fachdidaktik 2020 (S. 64-67). Regensburg: Gesellschaft für Fachdidaktik (GFD). Abgerufen von
 (1.17 MB)
Peschel, M. , Wedekind, H. , Kihm, P. , & Kelkel, M. . (2021). Hochschullernwerkstätten und Lernwerkstätten – Verortung in didaktischen Diskursen. In B. Holub, Himpsl-Gutermann, K. , Mittlböck, K. , Musilek-Hofer, M. , Varelija-Gerber, A. , & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (Bd. 9, Lernen und Studieren in Lernwerkstätten, S. 40-53). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von
 (1.5 MB)
Lauer, L. , Altmeyer, K. , Malone, S. , Barz, M. , Brünken, R. , Sonntag, D. , & Peschel, M.. (2021). Investigating the Usability of a Head-Mounted Display Augmented Reality Device in Elementary School Children. In Sensors (19. Aufl., Bd. 21, S. 1-20). doi:10.3390/s21196623
 (2.91 MB)
Kay, C. W. , Peschel, M. , Perels, F. , Lauer, L. , Seibert, J. , Lang, V. , u. a. (2021). Kompetenzentwicklung durch didaktisch eingebettete Augmented Reality. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 370-373). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von
 (890.96 KB)
Kay, C. W. , Peschel, M. , Perels, F. , Bach, S. , Kelkel, M. , Lauer, L. , u. a. (2021). Kompetenzentwicklung für die Naturwissenschaften durch Augmented Reality. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 362-365). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von
 (925.76 KB)
Kihm, P. , & Peschel, M. . (2021). „Komplexität wagen!“ – Methoden zur Beforschung von offenen Lehr-Lern-Prozessen in Hochschullernwerkstätten. In B. Holub, Himpsl-Gutermann, K. , Mittlböck, K. , Musilek-Hofer, M. , Varelija-Gerber, A. , & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (Bd. 9, Lernen und Studieren in Lernwerkstätten, S. 70-87). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von
 (299.52 KB)
Peschel, M. . (2021). Lernkulturen und Didaktik. Etablierung einer Lern-orientierten Didaktik über den Lern- und Kulturbegriff. In M. Peschel (Hrsg.), Didaktik der Lernkulturen (Bd. 153, Beiträge zur Reform der Grundschule, S. 7-29). Frankfurt a. M.: Grundschulverband e. V.
Wedekind, H. , Kihm, P. , & Peschel, M. . (2021). Lernwerkstattarbeit und Lernkulturen. Herausforderungen und Chancen einer Veränderung der Lernkultur durch Hochschullernwerkstätten. In M. Peschel (Hrsg.), Didaktik der Lernkulturen (Bd. 153, Beiträge zur Reform der Grundschule, S. 104-121). Frankfurt a. M.: Grundschulverband e. V.
Andersen, K. , Peschel, M. , & Neuböck-Hubinger, B.. (2021). LiST: Bildsprache als Ausgangspunkt von Sprach- und Facharbeit im Sachunterricht – empirische Ergebnisse zu Darstellungs- und Sprachebenen in Schulbüchern. In U. Franz, Giest, H. , Haltenberger, M. , Hartinger, A. , Kantreiter, J. , & Michalik, K. (Hrsg.), Sache und Sprache (Bd. 31, Probleme und Perspektiven des Sachunterrichts, S. 170-178). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2021). Medieneinsatz und Medienentwicklung im Sachunterricht am Beispiel von (digitalen) Karten. In N. Böhme, Dreer, B. , Hahn, H. , Heinecke, S. , Mannhaupt, G. , & Tänzer, S. (Hrsg.), Mythen, Widersprüche und Gewissheiten der Grundschulforschung. Eine wissenschaftliche Bestandsaufnahme nach 100 Jahren Grundschule (S. 187-193). Wiesbaden: Springer VS. doi:10.1007/978-3-658-31737-9_22
 (281.21 KB)
Weber, A. , Peschel, M. , Kihm, P. , Fischer, M. , & Dahm, T. . (2021). Phänomene am Schulanfang. „Mit offenen Augen durch die Welt und in die Schule gehen“. In Schulstart – was Kinder jetzt brauchen (Bd. 155, Grundschule aktuell, S. 22-23). Frankfurt a. M.: Grundschulverband e. V.
 (716.07 KB)
Kelkel, M. , Peschel, M. , & Kihm, P. . (2021). Potenziale der pädagogisch-didaktischen Öffnung in Hochschullernwerkstätten. In B. Holub, Himpsl-Gutermann, K. , Mittlböck, K. , Musilek-Hofer, M. , Varelija-Gerber, A. , & Grünberger, N. (Hrsg.), lern.medien.werk.statt. Hochschullernwerkstätten in der Digitalität (Bd. 9, Lernen und Studieren in Lernwerkstätten, S. 321-334). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von
 (1.6 MB)
Eichinger, A. , Schmoll, I. , Kelkel, M. , Seibert, J. , Lauer, L. , Lang, V. , u. a. (2021). QUANTAG: Augmented-Reality-Campus-Rallye als Einstieg in die Quantentechnologie. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 366-369). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von
 (951.97 KB)
Peschel, M. , Gervé, F. , Gryl, I. , Irion, T. , Schmeinck, D. , & Straube, P.. (2021). Sachunterricht und Digitalisierung. Positionspapier der GDSU (2021). In (S. 1-19).
Peschel, M. , Neuböck-Hubinger, B. , & Andersen, K.. (2021). Schwimmen oder treiben – sinken oder untergehen Die fachliche und semantische Bedeutung von Sprache im naturwissenschaftlich-orientierten Sachunterricht. In U. Franz, Giest, H. , Haltenberger, M. , Hartinger, A. , Kantreiter, J. , & Michalik, K. (Hrsg.), Sache und Sprache (Bd. 31, Probleme und Perspektiven des Sachunterrichts, S. 63-71). Bad Heilbrunn: Verlag Julius Klinkhardt.
Lauer, L. , Peschel, M. , Seibert, J. , Lang, V. , Eichinger, A. , Altmeyer, K. , u. a. (2021). Untersuchung der Wirkungen von AR-Visualisierungstechniken in der Primarstufe. In S. Habig (Hrsg.), Naturwissenschaftlicher Unterricht und Lehrerbildung im Umbruch? Gesellschaft für Didaktik der Chemie und Physik. Jahrestagung in Aachen 2020 (Bd. 41, Gesellschaft für Didaktik der Chemie und Physik (GDCP), S. 378-381). Regensburg: Gesellschaft für Didaktik der Chemie und Physik (GDCP). Abgerufen von
 (943.53 KB)
Seibert, J. , Marquardt, M. , Lang, V. , Lauer, L. , Peschel, M. , Perels, F. , u. a. (2020). AR-MEI-SE: Augmented Reality Multitouch Experiment Instruction in Science Education. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 952-955). Duisburg: Universität Duisburg-Essen. Abgerufen von
 (157.85 KB)
Marquardt, M. , Seibert, J. , Lauer, L. , Lang, V. , Peschel, M. , & Kay, C. W. . (2020). Augmented Reality als Werkzeug zur Verknüpfung des Periodensystems der Elemente mit dem Bohr’schen Atommodell. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 948-951). Duisburg: Universität Duisburg-Essen. Abgerufen von
 (311.6 KB)
Peschel, M. , Kay, C. W. , Lauer, L. , Seibert, J. , Marquardt, M. , & Lang, V. . (2020). Augmented Reality (AR) als Werkzeug im naturwissenschaftlichen Unterricht. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 940-943). Duisburg: Universität Duisburg-Essen. Abgerufen von
 (191.75 KB)
Lauer, L. , Peschel, M. , Marquardt, M. , Seibert, J. , Lang, V. , & Kay, C. W. . (2020). Augmented Reality (AR) in der Primarstufe – Entwicklung einer AR-gestützten Lehr-Lerneinheit zum Thema Elektrik. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 944-947). Duisburg: Universität Duisburg-Essen. Abgerufen von
 (201.25 KB)
Lang, V. , Seibert, J. , Marquardt, M. , Lauer, L. , Peschel, M. , Perels, F. , u. a. (2020). Augmented Reality Lab License 2.0. In S. Habig (Hrsg.), Naturwissenschaftliche Kompetenzen in der Gesellschaft von morgen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Wien 2019 (S. 956-959). Duisburg: Universität Duisburg-Essen. Abgerufen von
 (177.5 KB)
Seibert, J. , Lauer, L. , Marquardt, M. , Peschel, M. , & Kay, C. W. . (2020). deAR: didaktisch eingebettete Augmented Reality. In K. Kaspar, Becker-Mrotzek, M. , Hofhues, S. , König, J. , & Schmeinck, D. (Hrsg.), Bildung, Schule, Digitalisierung (S. 451-456). Münster: Waxmann Verlag.
 (1.18 MB)
Kihm, P. , Rech, E. , Schmidt, R. - J. , Senzig, H. , & Peschel, M. . (2020). „Digitalisierung und Schulschließungen“ in der SARS-CoV-2-Pandemie Berichtsanalyse im Zeitraum Januar bis Juli 2020. In Grundschule in und nach Corona (Bd. 152, Grundschule aktuell, S. 29-32). Frankfurt a. M.: Grundschulverband e. V.
Bach, S. . (2020). Eine Exkursion ins Museum und ihre mediale Aufbereitung mit kidipedia. Ein Beispiel zur Förderung fachlicher und medialer Kompetenzen. In U. Hecker, Lassek, M. , & Ramseger, J. (Hrsg.), Kinder lernen Zukunft. Anforderungen und tragfähige Grundlagen (Bd. 150, Beiträge zur Reform der Grundschule, S. 181-190). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P. , & Peschel, M. . (2020). Einflüsse von Aushandlungs- und Interaktionsprozessen auf Lernwerkstattarbeit. In U. Stadler-Altmann, Schumacher, S. , Emili, E. Angelo, & Torre, E. Dalla (Hrsg.), Spielen, Lernen, Arbeiten in Lernwerkstätten. Facetten der Kooperation und Kollaboration (Bd. 7, Lernen und Studieren in Lernwerkstätten, S. 87-99). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (208.06 KB)
Kihm, P. , & Töpler, M.. (2020). Grundschule aktuell – Heft 152 – Grundschule in und nach Corona. Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2020). Grundschulen müssen zu Schulen für JEDES Kind werden, erst dann sind sie eine Schule für ALLE Kinder!. In Forum Zukunft Grundschule (2). Medienbildung – Religion(en) – Inklusive Schule (Bd. 149, Grundschule aktuell, S. 2). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. , & Kihm, P. . (2020). Hochschullernwerkstätten – Rollen, Rollenverständnisse und Rollenaushandlungen. In K. Kramer, Rumpf, D. , Schöps, M. , & Winter, S. (Hrsg.), Hochschullernwerkstätten – Elemente von Hochschulentwicklung? Ein Rückblick auf 15 Jahre Hochschullernwerkstatt in Halle und andernorts (Bd. 8, Lernen und Studieren in Lernwerkstätten, S. 296-310). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (119.27 KB)
Bach, S. . (2020). Homeschooling – Mit kidipedia trotz Corona für die Schule lernen. Blogbeitrag im Blog der Heidelberg School of Education (HSE). Abgerufen von
Kihm, P. , & Peschel, M. . (2020). Lehr-Lern-Handeln an außerschulischen Lernorten (AL) – am Beispiel des Grundschullabors für Offenes Experimentieren (GOFEX). In L. Beyer, Gorr, C. , Kather, C. , Komorek, M. , Röben, P. , & Selle, S. (Hrsg.), Orte und Prozesse außerschulischen Lernens erforschen und weiterentwickeln. Tagungsband zur 6. Tagung Außerschulische Lernorte an der Carl von Ossietzky Universität Oldenburg vom 29.-31. August 2018 (Bd. 6, Außerschulische Lernorte – Beiträge zur Didaktik, S. 111-119). Münster: LIT Verlag.
Kunkel, C. , & Peschel, M. . (2020). Lernen mit und über digitale Medien im Sachunterricht. Entwicklung eines vielperspektivischen Konzepts zur Erschliessung digitaler Medien. In MedienPädagogik. Zeitschrift für Theorie und Praxis der Medienbildung (Bd. 17, Jahrbuch Medienpädagogik, S. 455-476).
 (1.11 MB)
Peschel, M. . (2020). Lernwerkstätten und Hochschullernwerkstätten. Begrifflichkeiten und Entwicklungen. In Journal für LehrerInnenbildung (jlb) (Bd. 3, S. 96-105). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von
 (394.84 KB)
Peschel, M. . (2020). Lernwerkstätten und Hochschullernwerkstätten. Lernwerkstätten und ihre Didaktik in der Hochschullehre.. In Zusammenarbeit an der Schule (Bd. Band 151, Grundschule aktuell, S. 34-35). Frankfurt a. M.: Grundschulverband e. V.
Lauer, L. , Peschel, M. , Bach, S. , & Seibert, J. . (2020). Modellierungen Medialen Lernens. In K. Kaspar, Becker-Mrotzek, M. , Hofhues, S. , König, J. , & Schmeinck, D. (Hrsg.), Bildung, Schule, Digitalisierung (S. 382-387). Münster: Waxmann Verlag.
 (644.96 KB)
Kelkel, M. , & Peschel, M. . (2020). Professionalisierung von Lehramtsstudierenden im GOFEX_Projektpraktikum durch Studierenden-Co-Reflexion. In U. Stadler-Altmann, Schumacher, S. , Emili, E. Angelo, & Torre, E. Dalla (Hrsg.), Spielen, Lernen, Arbeiten in Lernwerkstätten. Facetten der Kooperation und Kollaboration. (Bd. 7, Lernen und Studieren in Lernwerkstätten, S. 64-77). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (371.61 KB)
Kihm, P. , Diener, J. , & Peschel, M. . (2020). Qualifizierungsprozesse und Qualifikationsarbeiten in Hochschullernwerkstätten – Forschende Entwicklung einer innovativen Didaktik. In K. Kramer, Rumpf, D. , Schöps, M. , & Winter, S. (Hrsg.), Hochschullernwerkstätten – Elemente von Hochschulentwicklung? Ein Rückblick auf 15 Jahre Hochschullernwerkstatt in Halle und andernorts (Bd. 8, Lernen und Studieren in Lernwerkstätten, S. 321-335). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (123.07 KB)
Lauer, L. , Peschel, M. , Malone, S. , Altmeyer, K. , Brünken, R. , Javaheri, H. , u. a.. (2020). Real-time visualization of electrical circuit schematics: An augmented reality experiment setup to foster representational knowledge in introductory physics education. In The Physics Teacher (Bd. 58, S. 518-519).
Peschel, M. , Kihm, P. , Fischer, M. , Bützow, A. , Hoffmann, A. , Hoffmann, S. , u. a.. (2020). „Sachunterricht und Bildung". Eine Theorie des Sachunterrichts?! Erweiterte Rezension des Werkes von W. Köhnlein – mit Kommentaren von W. Köhnlein. In (Bd. Nr. 25).
 (475.94 KB)
Peschel, M. . (2020). Sprache und Sache. Sprachunterricht ist auch Fachunterricht. In U. Hecker, Lassek, M. , & Ramseger, J. (Hrsg.), Kinder lernen Zukunft. Über die Fächer hinaus – Prinzipien und Perspektiven (Bd. 151, Beiträge zur Reform der Grundschule, S. 125-136). Frankfurt a. M.: Grundschulverband e. V.
 (1.83 MB)
Peschel, M. . (2020). Welterschließung als sachunterrichtliches Lernen mit und über digitale Medien. In M. Thumel, Kammerl, R. , & Irion, T. (Hrsg.), Digitale Bildung im Grundschulalter. Grundsatzfragen zum Primat des Pädagogischen (S. 341-355). München: Kopaed Verlag.
Peschel, M. . (2019). Arme Kinder – arme Schule. Wie gerecht ist unser Bildungssystem?. In Forum Zukunft Grundschule (1). Bildung – Gerechtigkeit – Demokratie (Bd. 148, Grundschule aktuell, S. 26-29). Frankfurt a. M.: Grundschulverband e. V.
 (313.45 KB)
Huwer, J. , Lauer, L. , Dörrenbächer-Ulrich, L. , Perels, F. , & Thyssen, C. . (2019). Chemie neu erleben mit Augmented Reality. Neue Möglichkeiten der individuellen Förderung. In MNU Journal (05/2019. Aufl., S. 420-427). Neuss: Verlag Klaus Seeberger.
Peschel, M. . (2019). Digitalisierung und Demokratie. In Die Grundschulzeitschrift (Bd. 316, Lernen im Dialog, S. 48). Seelze: Friedrich Verlag.
Kihm, P. , & Peschel, M. . (2019). doing AGENCY – der Transfer von AGENCY-Elementen in Lernwerkstätten am Beispiel des Grundschullabors für Offenes Experimentieren. In S. Tänzer, Godau, M. , Berger, M. , & Mannhaupt, G. (Hrsg.), Perspektiven auf Hochschullernwerkstätten. Wechselspiele zwischen Individuum, Gemeinschaft, Ding und Raum (Bd. 6, Lernen und Studieren in Lernwerkstätten, S. 184-188). Bad Heilbrunn: Verlag Julius Klinkhardt.
Bach, S. , & Peschel, M. . (2019). Erweiterung des Medienangebotes in kidipedia – Entwicklung, Implementierung, Erprobung und Evaluation eines Mapping-Tools in Form digitaler, interaktiver Karten. In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (Bd. 11, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 137-152). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. , & Kihm, P. . (2019). Fachliche Kompetenz der Lernbegleitung in Lernwerkstätten. In R. Baar, Feindt, A. , & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Bd. 5, Lernen und Studieren in Lernwerkstätten, S. 84-95). Bad Heilbrunn: Verlag Julius Klinkhardt.
Kelkel, M. , & Markus, P. . (2019). Förderung der beruflichen Handlungsfähigkeit von Studierenden im Sachunterricht durch das GOFEX_Projektpraktikum. In S. Tänzer, Godau, M. , Berger, M. , & Mannhaupt, G. (Hrsg.), Perspektiven auf Hochschullernwerkstätten. Wechselspiele zwischen Individuum, Gemeinschaft, Ding und Raum (Bd. 6, Lernen und Studieren in Lernwerkstätten, S. 157-167). Bad Heilbrunn: Verlag Julius Klinkhardt.
Kihm, P. , Peschel, M. , & Diener, J. . (2019). Kinderfragen in der Lernwerkstatt. In R. Baar, Feindt, A. , & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Bd. 5, Lernen und Studieren in Lernwerkstätten, S. 109-120). Bad Heilbrunn: Verlag Julius Klinkhardt.
Diener, J. , & Peschel, M. . (2019). Lehrerhandeln im Grundschullabor für Offenes Experimentieren. In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (Bd. 11, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 11-34). Baltmannsweiler: Schneider Verlag Hohengehren.
Kelkel, M. , & Peschel, M. . (2019). Lernwerkstätten und Schülerlabore – Unterschiedliche Konzepte, ein Verbund. Kooperation zwischen GOFEX und NanoBioLab im Rahmen des GOFEX-Projektpraktikums als Beispiel für kooperatives Lernen. In R. Baar, Feindt, A. , & Trostmann, S. (Hrsg.), Struktur und Handlung in Lernwerkstätten. Hochschuldidaktische Räume zwischen Einschränkung und Ermöglichung (Bd. 5, Lernen und Studieren in Lernwerkstätten, S. 185-189). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2019). Milliarden für die Bildung. Grundlegende Forderungen an den Digitalpakt.. In Die Grundschulzeitschrift (Bd. 318, Visualisieren, S. 43). Seelze: Friedrich Verlag.
Peschel, M. , & Kihm, P. . (2019). Naturwissenschaftliche Phänomene im Grundschullabor für Offenes Experimentieren (GOFEX) entdecken. In Zeitschrift "Erziehung und Wissenschaft im Saarland" des Landesverbandes der GEW im DGB (02/2019. Aufl., Bd. 65. Jahrgang , S. 14-15).
 (846.91 KB)
Peschel, M. , & Carle, U. . (2019). Praxisforschung Sachunterricht. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. , Carle, U. , & Diener, J. . (2019). Praxisforschung Sachunterricht. In M. Peschel & Carle, U. (Hrsg.), Praxisforschung Sachunterricht (Bd. 11, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 5-10). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. , Gervé, F. , Irion, T. , Gryl, I. , & Schmeinck, D.. (2019). Sachunterricht und Digitalisierung. Positionspapier der GDSU (2019). In (S. 1-10). Berlin: GDSU e. V.
Peschel, M. . (2018). Digitales Lernen vs. analoges Lernen – Digitale Bildung in einer analogen Welt oder: Bildung für eine Welt mit digitalen Medien. In Wozu brauchen wir digitale Medien? (Bd. 142, Grundschule aktuell, S. 12-15). Frankfurt a. M.: Grundschulverband e. V.
Kelkel, M. , & Peschel, M. . (2018). Fachlichkeit in Lernwerkstätten. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (Bd. 4, Lernen und Studieren in Lernwerkstätten, S. 15-34). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. , & Kelkel, M. . (2018). Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten. Bad Heilbrunn: Verlag Julius Klinkhardt.
 (7.87 MB)
Schirra, S. , Peschel, M. , & Scherer, N. . (2018). „kidi on tour“ – Mobile Learning und das Potenzial digitaler Geomedien zur Vermittlung digitaler Raum-Zeitlichkeit am Beispiel von GOFEX und kidipedia. In M. Pietraß, Fromme, J. , Grell, P. , & Hug, T. (Hrsg.), Jahrbuch Medienpädagogik 14. Der digitale Raum – Medienpädagogische Untersuchungen und Perspektiven (S. 157-175). Wiesbaden: Springer VS.
 (843.24 KB)
Schirra, S. , & Peschel, M. . (2018). kidipedia. Digitale Medien pädagogisch sinnvoll im Unterricht einsetzen.. In EuWiS. Zeitung ‚Erziehung und Wissenschaft im Saarland’ des Landesverbandes der GEW im DGB (S. 13-14). Abgerufen von
 (8.91 MB)
Schirra, S. , & Peschel, M. . (2018). Kinder als ‚Geo-Producer’ – Kompetenzerwerb durch einen interaktiven Umgang mit digitalen Karten?. In GDSU-Journal 8 (S. 90-109). Berlin: GDSU e. V.
Kihm, P. , Diener, J. , & Peschel, M. . (2018). Kinder forschen – Wege zur (gemeinsamen) Erkenntnis. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten. Kind und Sache in Lernwerkstätten. (Bd. 4, Lernen und Studieren in Lernwerkstätten, S. 66-84). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (2.54 MB)
Peschel, M. , & Kelkel, M. . (2018). Potenziale von Lernwerkstätten zur Vermittlung von Handlungskompetenzen angehender Lehrkräfte – Chancen von Verbünden im Rahmen der Qualitätsoffensive Lehrerbildung. In H. Giest, Hartinger, A. , & Franz, U. (Hrsg.), GDSU-Journal 8 (S. 31-46). Berlin: GDSU e. V.
Huwer, J. , Lauer, L. , Seibert, J. , Thyssen, C. , Dörrenbächer-Ulrich, L. , & Perels, F. . (2018). Re-Experiencing Chemistry with Augmented Reality: New Possibilities for Individual Support. In World Journal of Chemical Education (5. Aufl., Bd. 6, S. 212-217). doi:10.12691/wjce-6-5-2
ValiZadeh, M. , & Peschel, M. . (2018). SelfPro – Entwicklung von Selbstkonzepten beim Offenen Experimentieren. In U. Franz, Giest, H. , Hartinger, A. , Heinrich-Dönges, A. , & Reinhoffer, B. (Hrsg.), Handeln im Sachunterricht (Bd. 28, Probleme und Perspektiven des Sachunterrichts, S. 183-190). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (8.71 MB)
Peschel, M. , & Kelkel, M. . (2018). Zur Sache!. In M. Peschel & Kelkel, M. (Hrsg.), Fachlichkeit in Lernwerkstätten – Kind und Sache in Lernwerkstätten (Bd. 4, Lernen und Studieren in Lernwerkstätten, S. 9-14). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. , Kihm, P. , Scherer, N. , & Kelkel, M. . (2017). Einstellungen zum Experimentieren im Lehramt Primarstufe. In LeLa Magazin (17. Aufl., Bd. März 2017, S. 12-13).
 (385.46 KB)
Peschel, M. , & Carle, U. . (2017). Forschung für die Praxis. Frankfurt a. M.: Grundschulverband e. V. Abgerufen von
Carle, U. , & Peschel, M. . (2017). Forschung für die Praxis – Plädoyer für schulpraktisch relevante Forschung. In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (Bd. 143, Beiträge zur Reform der Grundschule, S. 8-19). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P. , & Peschel, M. . (2017). Interaktion und Kommunikation beim Experimentieren von Kindern – Eine Untersuchung über interaktions- und kommunikationsförderliche Aufgabenformate. In M. Peschel & Carle, U. (Hrsg.), Forschung für die Praxis (Bd. 143, Beiträge zur Reform der Grundschule, S. 68-80). Frankfurt a. M.: Grundschulverband e. V.
Schirra, S. , & Peschel, M. . (2017). Kinder kindgerecht an digitale Medien heranführen. In KiTa aktuell. Fachzeitschrift für Leitungen, Fachkräfte und Träger der Kindertagesbetreuung (Bd. 25, S. 112-114).
Peschel, M. , & Lang, M. . (2017). Selbstkonzeptentwicklung durch Offenes Experimentieren. In GDSU-Journal 7 (S. S.65-77). Berlin: GDSU e. V.
 (360.19 KB)
Peschel, M. . (2017). SelfPro: Entwicklung von Professionsverständnissen und Selbstkonzepten angehender Lehrkräfte beim Offenen Experimentieren. In S. Miller, Holler-Nowitzki, B. , Kottmann, B. , Lesemann, S. , Letmathe-Henkel, B. , Meyer, N. , u. a. (Hrsg.), Profession und Disziplin – Grundschulpädagogik im Diskurs (Bd. 22, Jahrbuch Grundschulforschung, S. 191-196). Wiesbaden: Springer VS.
 (282.7 KB)
Schirra, S. , & Peschel, M. . (2017). Von Kids für Kids: Lernplattform kidipedia. Mediale und geografische Kompetenzen fördern. In Grundschulunterricht. Sachunterricht (Bd. 02/2017, S. 17-20).
Weber, A. . (2016). Ein Baum – Lebewesen und Lebensraum. In Lernkulturen. Wie Kinder lernen können (Bd. 136, Grundschule aktuell, S. 24-28). Frankfurt a. M.: Grundschulverband e. V. Abgerufen von
 (547.12 KB)
Peschel, M. . (2016). Energie als Perspektivenvernetzender Themenbereich im Sachunterricht. In C. Maurer (Hrsg.), Authentizität und Lernen – das Fach in der Fachdidaktik (Bd. 36, Gesellschaft für Didaktik der Chemie und Physik, S. 373-375). Regensburg: Universität Regensburg.
 (597.17 KB)
Peschel, M. . (2016). Entwicklung der selbst eingeschätzten Kompetenzen in der Sachunterrichtsausbildung im Saarland. In H. Giest, Goll, T. , & Hartinger, A. (Hrsg.), Sachunterricht – zwischen Kompetenzorientierung, Persönlichkeitsentwicklung, Lebenswelt und Fachbezug (Bd. 26, Probleme und Perspektiven des Sachunterrichts, S. 149-157). Bad Heilbrunn: Verlag Julius Klinkhardt.
Diehl, A. , & Peschel, M. . (2016). (Erneuerbare) Energie im Grundschullabor für Offenes Experimentieren. In C. Maurer (Hrsg.), Authentizität und Lernen – das Fach in der Fachdidaktik (Bd. 36, Gesellschaft für Didaktik der Chemie und Physik, S. 515-517). Regensburg: Universität Regensburg.
 (563 KB)
Kelkel, M. , Peschel, M. , & Urig, N. . (2016). GOFEX_EE – Erneuerbare Energien im praktischen Test. LeLa BNE Broschüre "Bildung für nachhaltige Entwicklung in Schülerlaboren", 62-65.
Irion, T. , & Peschel, M. . (2016). Grundschule und neue Medien – Neue Entwicklungen. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Bd. 141, Beiträge zur Reform der Grundschule, S. 11-15). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2016). Inklusive Mediendidaktik in der Grundschule. In G. Erziehung Wissenschaft (Hrsg.), Erfolgreich mit Neuen Medien! – Was bringt das Lernen im Netz? (S. 33-36). Frankfurt a. M.: GEW.
 (646.26 KB)
Peschel, M. , Schirra, S. , & Carell, S. . (2016). kidipedia – Ein Unterrichtsvorschlag. In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (Bd. 7, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 65-78). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2016). Lernkulturen in der Grundschule und im Sachunterricht. In Lernkulturen. Wie Kinder lernen können (Bd. 136, Grundschule aktuell, S. S. 3-6). Frankfurt a. M.: Grundschulverband e. V. Abgerufen von
 (414.61 KB)
Peschel, M. (Hrsg.). (2016). Mediales Lernen – Beispiele für eine inklusive Mediendidaktik. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2016). Mediales Lernen – Eine Modellierung als Einleitung. In M. Peschel (Hrsg.), Mediales Lernen – Beispiele für eine Inklusive Mediendidaktik (Bd. 7, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 7-16). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2016). Medienlernen im Sachunterricht – Lernen mit Medien und Lernen über Medien. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Bd. 141, Beiträge zur Reform der Grundschule, S. 33-49). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2016). Neue Medien in der Grundschule 3.0. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Bd. 141, Beiträge zur Reform der Grundschule, S. 189-192). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2016). Offenes Experimentieren – Individuelles Lernen: Aufgaben in Lernwerkstätten. In H. Hahn, Esslinger-Hinz, I. , & Panagiotopoulou, A. (Hrsg.), Paradigmen und Paradigmenwechsel in der Grundschulpädagogik (S. S. 120-131). Baltmannsweiler: Schneider Verlag Hohengehren.
 (7.26 MB)
Schirra, S. , & Peschel, M. . (2016). Recherchieren, Dokumentieren und Präsentieren mit kidipedia im Zeitalter von Tablets & Co. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Beiträge zur Reform der Grundschule., Bd. 141, S. 235-246). Frankfurt a. M.: Grundschulverband e. V.
Schirra, S. , & Peschel, M. . (2016). Was geht? Neue Medien im Sachunterricht. In M. Peschel & Irion, T. (Hrsg.), Neue Medien in der Grundschule 2.0 (Bd. 141, Beiträge zur Reform der Grundschule, S. 309-315). Frankfurt a. M.: Grundschulverband e. V.
Kihm, P. , Knopf, J. , & Ladel, S. . (2015). „Cu l8er – Cu2 :-)" – Was Kinder aus der SMS-Kommunikation lernen können. In Grundschulunterricht Mathematik (Bd. 1, S. 19-22). München: Oldenbourg Verlag.
Schröder, C.. (2015). Das Weltsozialforum. Bewegte Organisation oder organisierte Bewegung? (S. 280). Bielefeld: Transcript Verlag.
Carell, S. , & Peschel, M. . (2015). Einfluss des Onlinelexikons kidipedia auf die Naturwissenschaftskompetenz von Jungen und Mädchen an Schweizer Primschulen. In D. Blömer, Lichtblau, M. , Jüttner, A. - K. , Koch, K. , Krüger, M. , & Werning, R. (Hrsg.), Perspektiven auf inklusive Bildung – Gemeinsam anders lehren und lernen (Bd. 18, Jahrbuch Grundschulforschung, S. 216-223). Wiesbaden: Springer VS.
 (662.42 KB)
Diehl, A. , & Peschel, M. . (2015). GOFEX – Erneuerbare Energien. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung – Festschrift, 43.
Schirra, S. , Warken, T. , & Peschel, M. . (2015). kidipedia – Einsatz eines (audio-)visuellen Bildungsmediums im geographisch-orientierten Sachunterricht. In bildungsforschung (Bd. 1, S. 118-146).
 (3.27 MB)
Carell, S. , & Peschel, M. . (2015). Kompetenzentwicklung und Interessensveränderung im Sachunterricht bei Jungen und Mädchen aus Schweizer Primarschulen durch den Einsatz eines Onlinelexikons (kidipedia) für Kinder. In H. - J. Fischer, Giest, H. , & Michalik, K. (Hrsg.), Bildung im und durch Sachunterricht (Bd. 25, Probleme und Perspektiven des Sachunterrichts, S. 101-106). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von
Peschel, M. . (2015). Konzeption des Grundschullabors für Offenes Experimentieren (GOFEX) – Elemente der Öffnung. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung – Festschrift, 122-123.
Peschel, M. , & Meiers, K. . (2015). Lesen im Sachunterricht. In Sache Wort Zahl. Lehren und Lernen in der Grundschule, Heft 150-151/43 (S. 60-69). Hallbergmoos: Aulis Verlag.
Peschel, M. . (2015). Medien im Sachunterricht. Unterricht gestalten – Lernkulturen entwickeln. In Medienbildung (Bd. 131, Grundschule aktuell, S. 10-14). Frankfurt a. M.: Grundschulverband e. V.
Peschel, M. . (2015). Medienerziehung im Sachunterricht. In J. Kahlert, Fölling-Albers, M. , Götz, M. , Miller, S. , & Wittkowske, S. (Hrsg.), Handbuch Didaktik des Sachunterrichts (S. 173-179). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2015). Offenes Experimentieren – das Projekt SelfPro. In H. - J. Fischer, Giest, H. , & Michalik, K. (Hrsg.), Bildung im und durch Sachunterricht (Bd. 25, Probleme und Perspektiven des Sachunterrichts, S. 59-64). Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von
Lang, M. , & Peschel, M. . (2015). SINUS trifft GOFEX. (L. Labor, Hrsg.)10 Jahre LeLa Jahrestagung – Festschrift, 79.
Peschel, M. . (2014). Außerschulische Lernorte in der Sachunterrichtsausbildung. In D. Brovelli, Fuchs, K. , Rempfler, A. , & Häller, B. Sommer (Hrsg.), Ausserschulische Lernorte – Impulse aus der Praxis (S. 131-136). Münster: LIT Verlag.
Fischer, H. - J. , Giest, H. , & Peschel, M. . (2014). Editorial. In H. - J. Fischer, Giest, H. , & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (Bd. 24, Probleme und Perspektiven des Sachunterrichts, S. 9-16). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (564.22 KB)
Giest, H. , & Peschel, M. . (2014). Editorial. In H. Giest & Peschel, M. (Hrsg.), GDSU-Journal (Bd. 4, GDSU-Journal, S. 7-8). Berlin: GDSU e. V. Abgerufen von
Giest, H. , & Peschel, M. . (2014). GDSU-Journal Juli 2014, Heft 4. Berlin: GDSU e. V.
 (697.33 KB)
Peschel, M. . (2014). Individuelle Förderung beim naturwissenschaftlichen Lernen im Sachunterricht der Grundschule. In (Bd. 2, Zeitschrift für Grundschulforschung, S. 146-160). Bad Heilbrunn: Verlag Julius Klinkhardt.
Carell, S. , & Peschel, M. . (2014). kidipedia – Ergebnisse eines Forschungsprojekts im Sachunterricht. In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (Bd. 34, S. 489-491). Kiel: IPN.
 (1.34 MB)
Peschel, M. , & Koch, A. . (2014). Lehrertypen – Typisch Lehrer?! Clusterungen im Projekt SUN. In S. Bernholt (Hrsg.), Naturwissenschaftliche Bildung zwischen Science- und Fachunterricht. (Bd. 34, S. 216-218). Kiel: IPN.
 (1.27 MB)
Peschel, M. . (2014). Lernen mit und über Medien – Mediales Lernen im neuen Perspektivrahmen. In Grundschulmagazin (Bd. 2, S. 26-30). München: Oldenbourg Verlag.
Hildebrandt, E. , Peschel, M. , & Weißhaupt, M.. (2014). Lernen zwischen freiem und instruiertem Tätigsein. Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von
 (1.76 MB)
Hildebrandt, E. , Peschel, M. , & Weißhaupt, M.. (2014). Lernen zwischen freiem und instruiertem Tätigsein – eine Einführung. In E. Hildebrandt, Peschel, M. , & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (1, Lernen und Studieren in Lernwerkstätten. Aufl., S. 9-13). Bad Heilbrunn: Verlag Julius Klinkhardt. doi:10.35468/5375_01
 (55.86 KB)
Fischer, H. Joachim, Giest, H. , & Peschel, M. . (2014). Lernsituationen und Aufgabenkultur im Sachunterricht. Bad Heilbrunn: Verlag Julius Klinkhardt. Abgerufen von
Peschel, M. . (2014). Medienerziehung. In A. Hartinger & Lange, K. (Hrsg.), Sachunterricht – Didaktik für die Grundschule (S. 158-169). Berlin: Cornelsen Scriptor Verlag.
Carell, S. , & Peschel, M. . (2014). Motivations- und Interessenveränderungen bei der Arbeit mit In H. - J. Fischer, Giest, H. , & Peschel, M. (Hrsg.), Lernsituationen und Aufgabenkultur im Sachunterricht (Bd. 24, Probleme und Perspektiven des Sachunterrichts, S. 79-86). Bad Heilbrunn: Verlag Julius Klinkhardt.
Czepukojc, B. , Baltes, A. - K. , Kelkel, M. , Cerella, C. , Viswanathan, U. Maheswari, Salm, F. , u. a. (2014). Towards pharmaceutically useful, redox-modulating polysulfanes based on naturally occurring garlic compounds. In Food and Chemical Toxicology (Bd. 64, S. 249-257).
Peschel, M. . (2014). Vom instruierten zum Freien Forschen – Selbstbestimmungskonzepte im GOFEX. In E. Hildebrandt, Peschel, M. , & Weißhaupt, M. (Hrsg.), Lernen zwischen freiem und instruiertem Tätigsein (Bd. 1, Lernen und Studieren in Lernwerkstätten, S. 67-79). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (109.44 KB)
 (735.13 KB)
Kelkel, M. , & Peschel, M. . (2014). Wer macht die Nacht? – Das Phänomen Nacht naturwissenschaftlich erkunden. In kindergarten heute (Bd. 06/2014, S. 32-34). Freiburg i. Br.: Verlag Herder.
Peschel, M. , Favre, P. , & Mathis, C. . (2013). Einleitung. In M. Peschel, Favre, P. , & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Dimensionen des Sachunterrichts – Kinder.Sachen.Welten., S. 5-6). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. , & Carell, S. . (2013). Entwicklungen in der Medienpädagogik von Mosaik (1992/1993) zu kidipedia (2012) – zukunftsfähige Konzeption für den Sachunterricht?. In H. - J. Fischer, Giest, H. , & Pech, D. (Hrsg.), Der Sachunterricht und seine Didaktik – Bestände prüfen und Perspektiven entwickeln (Bd. 23, Probleme und Perspektiven des Sachunterrichts, S. 121-128). Bad Heilbrunn: Verlag Julius Klinkhardt.
Schumacher, A. , & Peschel, M. . (2013). Forschendes Lernen im Grundschullabor für Offenes Experimentieren (GOFEX). In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (Bd. 33, S. 545-547). Kiel: IPN.
 (919.59 KB)
Carell, S. , & Peschel, M. . (2013). Forschendes Lernen im Web 2.0 – kidipedia. In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik (Bd. 33, S. 560–562). Kiel: IPN.
 (785.23 KB)
Peschel, M. , Köster, H. , & Zimmermann, M.. (2013). Forschendes Lernen in der Frühpädagogik und im Sachunterricht. In S. Bernhold (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung in Hannover 2012. (Bd. 33, S. 542-544). Kiel: IPN.
 (693.6 KB)
Peschel, M. . (2013). GOFEX – Ort des Lehrens und Lernens. In E. Wannack, Bosshart, S. , Eichenberger, A. , Fuchs, M. , Hardegger, E. , & Marti, S. (Hrsg.), 4-12-jährige – Ihre schulischen und außerschulischen Lern- und Lebenswelten (S. 260-268). Münster: Waxmann Verlag.
 (1.81 MB)
Peschel, M. , & Schumacher, A. . (2013). Grundschullabor für Offenes Experimentieren – Lehr- und Lernort für Schülerinnen und Schüler, Studierende und Lehrpersonen. In H. Coelen & Müller-Naendrup, B. (Hrsg.), Studieren in Lernwerkstätten. Potentiale und Herausforderungen für die Lehrerbildung (S. 85-91). Wiesbaden: Springer VS. doi:10.1007/978-3-658-00315-9_7
 (1.23 MB)
Peschel, M. . (2013). Gute Aufgaben für forschendes Lernen im experimentierenden Sachunterricht. In S. Bernholt (Hrsg.), Inquiry-based learning – Forschendes Lernen. Gesellschaft für Didaktik der Chemie und Physik, Jahrestagung Hannover 2012 (Bd. 33, S. 128-130). Kiel: IPN.
 (697.91 KB)
Gervé, F. , & Peschel, M.. (2013). Medien im Sachunterricht. In E. Gläser & Schönknecht, G. (Hrsg.), Sachunterricht in der Grundschule (S. 58-79). Frankfurt a. M.: Arbeitskreis Grundschule – Der Grundschulverband.
Peschel, M. . (2013). Perspektivenvernetzender Themenbereich Medien. In Perspektivrahmen Sachunterricht (S. 83–85). Bad Heilbrunn: Verlag Julius Klinkhardt.
Schröder, C.. (2013). Politische Umbrüche und Soziale Arbeit in der Maghreb-Maschrek-Region. In Weltatlas Sozialen Arbeit – Jenseits aller Vermessungen (S. 32-51). Weinheim: Beltz Juventa Verlag.
Schröder, C.. (2013). Quién define lo que es el FSM? . In (Foro Social Mundial: ¿Momento de replanteamientos?).
 (861.14 KB)
Peschel, M. , Favre, P. , & Mathis, C. . (2013). SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. , Favre, P. , & Mathis, C. . (2013). Sachunterricht im Wandel. In M. Peschel, Favre, P. , & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Bd. 6, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 7-20). Baltmannsweiler: Schneider Verlag Hohengehren.
Mathis, C. , & Peschel, M. . (2013). Sachunterrichtsstudium für die Vorschul-/Primarstufe an der Pädagogischen Hochschule FHNW. In M. Peschel, Favre, P. , & Mathis, C. (Hrsg.), SaCHen unterriCHten – Beiträge zur Situation der Sachunterrichtsdidaktik in der deutschsprachigen Schweiz (Bd. 6, Dimensionen des Sachunterrichts – Kinder.Sachen.Welten, S. 67-82). Baltmannsweiler: Schneider Verlag Hohengehren.
Czepukojc, B. , Baltes, A. - K. , Cerella, C. , Kelkel, M. , Viswanathan, U. Maheswari, Salm, F. , u. a. (2013). Synthetic polysulfane derivatives induce cell cycle arrest and apoptotic cell death in human hematopoietic cancer cells. In Food and chemical toxicology: an international journal published for the British Industrial Biological Research Association 64.
 (1.23 MB)
Schröder, C. , & Homfeldt, H. Günther. (2013). Transnationales Wissen in NGOs. In Transnationales Wissen und Soziale Arbeit. Weinheim: Beltz Juventa Verlag.
Peschel, M. . (2013). Vergleichen und Recherchieren. In (Hrsg.), Perspektivrahmen Sachunterricht (S. 148–152). Bad Heilbrunn: Verlag Julius Klinkhardt.
Bähr, C. , Homfeldt, H. Günther, Schröder, C. , Schröer, W. , & Schweppe, C. . (2013). Weltatlas Sozialen Arbeit – Jenseits aller Vermessungen. Weinheim: Beltz Juventa Verlag.
Schröder, C.. (2013). Who defines what the World Social Forum is?. In (Foro Social Mundial: ¿Momento de replanteamientos?).
 (128.25 KB)
Peschel, M. . (2012). Dann musst Du am Automaten neues Geld kaufen! – Wie funktioniert eigentlich ein Automat? Eine Frage, die nicht nur Kinder interessiert. In Fachzeitschrift für Kindergarten und Unterstufe, (Bd. 4-8, S. 27-30).
 (624.31 KB)
Carell, S. , & Peschel, M. . (2012). Die Internetplattform kidipedia im Unterricht sinnvoll nutzen. In " GDSU" (Hrsg.), GDSU-Journal (Bd. 2, S. 57-66).
 (136.3 KB)
Peschel, M. . (2012). Gute Aufgaben im Sachunterricht – Offene Werkstätten = Gute Aufgaben?. In U. Carle & Kosinar, J. (Hrsg.), Aufgabenqualität in der Grundschule (S. 161-172). Baltmannsweiler: Schneider Verlag Hohengehren.
 (1.84 MB)
Peschel, M. , & Carell, S. . (2012). Kidipedia – Unterstützungsangebot für Mädchen & Jungen im Sachunterricht. In S. Bernholt (Hrsg.), Konzepte fachdidaktischer Strukturierung für den Unterricht (Bd. 32, S. S. 464-467). Münster: LIT Verlag.
Peschel, M. . (2012). Mediendidaktik, Medienkompetenz, Medienerziehung – Web 2.0 Aktivitäten im Sachunterricht. In " GDSU" (Hrsg.), GDSU-Journal (Bd. 2, S. 67-79).
 (86.21 KB)
Peschel, M. , & Schumacher, A. . (2012). Neue Wege beim Experimentieren. Schulblatt der Kantone Aargau und Solothurn.
Peschel, M. , & Streit, C. . (2012). Physik und Mathe können lustvoll gelernt werden. Bildungsseite der Aargauer Zeitung und der Basler Zeitung.
Kelkel, M. , Cerella, C. , Mack, F. , Schneider, T. , Jacob, C. , Schumacher, M. , u. a. (2012). ROS-independent JNK activation and multisite phosphorylation of Bcl-2 link diallyl tetrasulfide-induced mitotic arrest to apoptosis. In Carcinogenesis (11. Aufl., Bd. 33, S. 2162-2171).
 (2.44 MB)
Kelkel, M. , Schumacher, M. , Dicato, M. , & Diederich, M. F. . (2011). Antioxidant and anti-proliferative properties of lycopene. In Free Radical Research (8. Aufl., Bd. 45, S. 925-940). doi: 10.3109/10715762.2011.564168
 (447.21 KB)
Peschel, M. . (2011). Der Lernstick und die Schulfächer – Versuch einer Übersicht. In H. - U. Grunder (Hrsg.), mLearning in der Schule. Der Lernstick als Lerninstrument (S. 51-72). Baltmannsweiler: Schneider Verlag Hohengehren.
Schumacher, M. , Kelkel, M. , Dicato, M. , & Diederich, M. F. . (2011). Gold from the sea: Marine compounds as inhibitors of the hallmarks of cancer. In Biotechnology Advances (5. Aufl., Bd. 29, S. 531-547).
 (1.92 MB)
Peschel, M. . (2011). kidipedia – Ein Onlinelexikon von Kids für Kids. In H. Giest, Kaiser, A. , & Schomaker, C. (Hrsg.), Sachunterricht – auf dem Weg zur Inklusion (Bd. 21, Probleme und Perspektiven des Sachunterrichts, S. 193-198). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (373.11 KB)
Peschel, M. , & Streit, C. . (2011). Lern-Atelier in Solothurn eröffnet. Schulblatt der Kantone Aargau und Solothurn.
Peschel, M. . (2011). Macht der Mond die Nacht? – Tag und Nacht im Kindergarten. In Weltwissen Sachunterricht (Bd. Heft 03/2011, S. 6-7). Braunschweig: Westermann Verlag. Abgerufen von
 (1.09 MB)
Peschel, M. . (2011). Medienerziehung und schulische Sozialerziehung. In M. Limbourg & Steins, G. (Hrsg.), Sozialerziehung in der Schule (S. 451-474). Wiesbaden: VS Verlag für Sozialwissenschaften.
Schröder, C.. (2011). “Mit vereinten Kräften voran”. Social Development in einem Kooperationsprojekt einer transnationaeln NGO und einer loken NGO. In Soziale Arbeit als Entwicklungszusammenarbeit. Baltmannsweiler: Schneider Verlag Hohengehren.
Cerella, C. , Kelkel, M. , Viry, E. , Dicato, M. , Jacob, C. , & Diederich, M. F. . (2011). Naturally Occurring Organic Sulfur Compounds: An Example of a Multitasking Class of Phytochemicals in Anti-Cancer Research. In Phytochemcials.
 (711.62 KB)
Schröder, C.. (2011). Researching the World Social Forum. My First Steps into the Field. In Transnational Social Review (Bd. 1).
 (398.73 KB)
Schneider, T. , Baldauf, A. , Schneider, M. , Burkholz, T. , Kelkel, M. , & Jacob, C. . (2011). Selective Antimicrobial Activity Associated with Sulfur Nanoparticles. In Journal of Biomedical Nanotechnology (3. Aufl., Bd. 7, S. 395405). doi:10.1166/jbn.2011.1293
 (1.28 MB)
Schumacher, M. , Kelkel, M. , Dicato, M. , & Diederich, M. F. . (2011). A Survey of Marine Natural Compounds and Their Derivatives with Anti-Cancer Activity Reported in 2010. In molecules (Bd. 16, S. 5629-5646). doi:10.3390/molecules16075629
 (2.1 MB)
Peschel, M. . (2011). Wege zum Offenen Experimentieren. (K. Scheler, Hrsg.)Wissenschaft trifft Praxis – Bericht von der Expertentagung zur frühen naturwissenschaftlichen Bildung, Forscherstation – Heidelberg, 48-54.
Kelkel, M. , Boyer-Orlikova, B. , & Diederich, M. F. . (2010). Decrypting the labyrinth of inflammatory cell signaling pathways: Editorial to the meeting "Inflammation 2010". In Journal of Cell Communication and Signaling 4(4) (S. 159-60).
 (67.68 KB)
Peschel, M. , Weißer, P. , & Schäfer, J. . (2010). Der Zucker nimmt die Tinte Huckepack – Kooperationen zwischen Schule und Universität. In Sache – Wort – Zahl (SWZ) (Heft 112, 09/2010, 38. Jhg., S. 48-56). Hallbergmoos: Aulis Verlag.
 (1.55 MB)
Peschel, M. , & Struzyna, S. . (2010). GOFEX – Grundschullabor für Offenes Experimentieren: Entwicklung eines Raumkonzeptes als Element der Öffnung. In K. - H. Arnold, Hauenschild, K. , Schmidt, B. , & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung (Bd. 14, Jahrbuch Grundschulforschung, S. 197-200). Wiesbaden: VS Verlag für Sozialwissenschaften.
 (1.52 MB)
Peschel, M. , & Carell, S. . (2010). Grundschullabor für Offenes Experimentieren. Das Materialkonzept.. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 461-463). Münster: LIT Verlag.
 (5.36 MB)
Peschel, M. . (2010). Grundschullabor für Offenes Experimentieren – Grundschultransfer?. In H. Giest & Pech, D. (Hrsg.), Anschlussfähige Bildung im Sachunterricht (Bd. 20, Probleme und Perspektiven des Sachunterrichts, S. 49-57). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (9.28 MB)
Peschel, M. . (2010). kidipedia – Präsentieren von Sachunterrichtsergebnissen im Internet. In M. Peschel (Hrsg.), Neue Medien im Sachunterricht (S. 71-78). Baltmannsweiler: Schneider Verlag Hohengehren.
 (706.07 KB)
Peschel, M. . (2010). kidipedia – Untersuchung der Machbarkeit einer neuartigen Online-Plattform. Arbeitspapiere der Hans-Böckler-Stiftung (Bd. 190). Düsseldorf: Setzkasten. Abgerufen von
 (4.34 MB)
Peschel, M. . (2010). – Eine Präsentationsplattform im Internet für Sachunterrichtsergebnisse. In K. - H. Arnold, Hauenschild, K. , Schmidt, B. , & Ziegenmeyer, B. (Hrsg.), Zwischen Fachdidaktik und Stufendidaktik. Perspektiven für die Grundschulforschung (Bd. 14, Jahrbuch Grundschulforschung, S. 193-196). Wiesbaden: VS Verlag für Sozialwissenschaften.
Peschel, M. , & Struzyna, S. . (2010). Konzeption eines Grundschullabors für Offenes Experimentieren (GOFEX). Der Raum als Element der Öffnung.. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 458-460). Münster: LIT Verlag.
 (4.36 MB)
Peschel, M. . (2010). Luft und Vakuum. Experimente mit Luft .. und ohne!. In Sache – Wort – Zahl (SWZ) (Bd. Heft 108, 03/2010, 38. Jhg., S. 23-25). Hallbergmoos: Aulis Verlag.
 (748.87 KB)
Peschel, M. , & Herrmann, C. . (2010). Materialaspekt im Sachunterricht – Einflüsse des Materials auf die physikalischen Anteile des Sachunterrichts. In D. Höttecke (Hrsg.), Entwicklung naturwissenschaftlichen Denkens zwischen Phänomen und Systematik (Bd. 30, S. 455-457). Münster: LIT Verlag.
Peschel, M. . (2010). Neue Medien im Sachunterricht. Gestern – Heute – Morgen. Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2010). Neue Medien in Forschung und Praxis. Ergebnisse aus der Arbeitsgruppe Neue Medien (ICT) im Sachunterricht der GDSU. In Weltwissen Sachunterricht (Bd. Heft 4, Nov. 2010, S. 54).
 (228.35 KB)
Peschel, M. , & Carell, S. . (2010). Nutzungsweise computergestützter Medien – Unterschiede zwischen Jungen und Mädchen?!. In Neue Medien im Sachunterricht (S. 79-86). Baltmannsweiler: Schneider Verlag Hohengehren.
Kelkel, M. , Jacob, C. , Dicato, M. , & Diederich, M. F. . (2010). Potential of the Dietary Antioxidants Resveratrol and Curcumin in Prevention and Treatment of Hematologic Malignancie. In Molecules (10. Aufl., Bd. 15, S. 7035-7074). doi:10.3390/molecules15107035
 (792.79 KB)
Peschel, M. . (2009). Alleine geht es gut, zusammen manchmal besser! – Kooperationen im Sachunterricht beim Experimentieren. In Sache – Wort – Zahl (SWZ) (Bd. Heft 101, 04/2009, 37 Jhg., S. 23-27). Hallbergmoos: Aulis Verlag.
 (7.55 MB)
Peschel, M. . (2009). Aus- und Fortbildungen für den naturwissenschaftlich-physikalischen Sachunterricht. In R. Lauterbach, Giest, H. , & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (Bd. 19, Probleme und Perspektiven des Sachunterrichts, S. 149-156). Bad Heilbrunn: Verlag Julius Klinkhardt.
Peschel, M. . (2009). Der Begriff der Offenheit beim Offenen Experimentieren. In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 268-270). Münster: LIT Verlag.
 (3.82 MB)
Peschel, M. . (2009). GOFEX – Grundschullabor für Offenes Experimentieren. Grundlegende Konzeption. In R. Lauterbach, Giest, H. , & Marquardt-Mau, B. (Hrsg.), Lernen und kindliche Entwicklung (Bd. 19, Probleme und Perspektiven des Sachunterrichts, S. 229-236). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (528.97 KB)
Peschel, M. . (2009). Naturwissenschaftliche Aus- und Fortbildung für den Sachunterricht – Ergebnisse aus dem Projekt SUN zum physikbezogenen Sachunterricht. In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 143-145). Münster: LIT Verlag.
Peschel, M. , & Giest, H. . (2009). Spielen am Computer – Chancen für den Sachunterricht. In Grundschulunterricht – Sachunterricht (Bd. 02/2009, S. 33-37). München: Oldenbourg Verlag.
 (989.62 KB)
Peschel, M. , & Bürger, C.. (2009). Unterrichtsbedingungen für physikalischen Sachunterricht (SUN). In D. Höttecke (Hrsg.), Chemie- und Physikdidaktik für die Lehramtsausbildung (S. 428-430). Münster: LIT Verlag.
Peschel, M. . (2008). GOFEX – Grundschullabor für Offenes Experimentieren. In Didaktik der Physik. Berlin: Lehmanns Media.
Peschel, M. . (2008). kidipedia – Ein Wikipedia für Kids. Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung, 70-72.
Peschel, M. . (2008). Offenes Experimentieren – Chancen für Jungen und Mädchen!. In J. Ramsberger & Ramsberger, W. (Hrsg.), Chancengleichheit in der Grundschule. Ursachen und Wege aus der Krise (Bd. 12, Jahrbuch Grundschulforschung). Wiesbaden: VS Verlag für Sozialwissenschaften.
 (88.68 KB)
Peschel, M. . (2008). Schriftanlässe – Kommunikation im Schriftspracherwerb. In Grundschule Deutsch (Bd. 02/2008). München: Oldenbourg Verlag.
 (5.57 MB)
Peschel, M. . (2008). SUN: Erhebung der Lehrvoraussetzungen und des Professionswissens von Lehrenden im Sachunterricht der Grundschule. Zentrum für Lehrerbildung Essen: Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung, 68-70.
Gebauer, M. , & Peschel, M. . (2007). Duden: Sachunterricht 4. Ausgabe Thüringen.
Gebauer, M. , & Peschel, M. . (2007). Duden: Sachunterricht. Ausgabe Sachsen-Anhalt.
Peschel, M. . (2007). Konzeption einer Studie zu den Lehrvoraussetzungen und dem Professionswissen von Lehrenden im Sachunterricht der Grundschule in NRW. Das Projekt SUN. In R. Lauterbach, Hartinger, A. , Feige, B. , & Cech, D. (Hrsg.), Kompetenzerwerb im Sachunterricht fördern und erfassen (Bd. 17, Probleme und Perspektiven des Sachunterrichts, S. 151-160). Bad Heilbrunn: Verlag Julius Klinkhardt.
 (713.99 KB)
Peschel, M. , & Gabriel, P. . (2007). Naturwissenschaftliche Profilklasse – Eine Kooperation zwischen der Universität Duisburg-Essen und dem MPG-Duisburg. In Didaktik der Physik. Berlin: Lehmanns Media.
Peschel, M. . (2007). Sinne. In: M. Gebauer & M. Peschel (Hrsg.): Duden: Sachunterricht 4. Ausgabe Thüringen. (M. Gebauer & Peschel, M. , Hrsg.).
Peschel, M. , & Struzyna, S. . (2007). Wer unterrichtet unsere Kinder? SUN – Sachunterricht in Nordrhein-Westfalen. In K. möller, Hanke, P. , Beinbrech, C. , Hein, A. , Kleickmann, T. , & Schages, R. (Hrsg.), Qualität von Grundschulunterricht entwickeln, erfassen und bewerten (Bd. 11, Jahrbuch Grundschulforschung, S. 171-174). Bonn: Verlag für Sozialwissenschaften.
 (111.99 KB)
Peschel, M. . (2006). Das Mobile Computerlabor. Konzeption und Anwendungen. In V. Nordmeier & Oberländer, A. (Hrsg.), Didaktik der Physik Kassel. Berlin: Lehmanns Media.
Peschel, M. . (2006). Der Computer zur Präsentation von Experimenten im Sachunterricht. In Zeitschrift Grundschulunterricht (Bd. 05/2006, S. S. 31-34). München: Oldenbourg Verlag.
Peschel, M. . (2006). LDS im Werkstattunterricht. Defintion und Abgrenzung. In R. Hinz & Pütz, T. (Hrsg.), Professionelles Handeln in der Grundschule (Entwicklungslinien der Grundschulpädagogik., Bd. 3, S. 159-166). Baltmannsweiler: Schneider Verlag Hohengehren.
Peschel, M. . (2006). Lehrvoraussetzungen und Professionswissen von Lehrenden im Sachunterricht der Grundschule. (A. Pitton, Hrsg.)Fachdidaktische Forschung – Empirische Lehr-Lern-Forschung. Essen, 88 ff.
Peschel, M. . (2006). Sachunterricht und Lautorientierter Schriftspracherwerb. In R. Hinz & Schumacher, B. (Hrsg.), Auf den Anfang kommt es an: Kompetenzen entwickeln – Kompetenzen stärken (S. S. 67-76). Wiesbaden: VS Verlag für Sozialwissenschaften. Abgerufen von
 (150.25 KB)
Peschel, M. . (2005). Lernchance Computer?. Tagungsband der Hans-Böckler-Stiftung.
Peschel, M. , Fröhler, N. , Hürtgen, S. , Schlüter, C. , & Thiedke, M. . (2004). „Demokratie beginnt in der Schule .. auch nach PISA .. !?“. Ergebnisse von PISA 2000. In Wir können auch anders. Perspektiven von Demokratie und Partizipation (Schriftenreihe Hans-Böckler-Stiftung.). Münster: Dampfboot Verlag.
Peschel, M. . (2003). Die "Dichterlesung". Ein Element der schriftlichen Kommunikation beim Schriftspracherwerb mit "Lesen durch Schreiben". In A. Panagiotopoulou & Brügelmann, H. (Hrsg.), Grundschulpädagogik meets Kindheitsforschung. Zum Wechselverständnis von schulischem Lernen und außerschulischen Erfahrungen im Grundschulalter (Jahrbuch Grundschulforschung., S. 145-149). Opladen: Leske + Budrich Verlag.
Peschel, M. . (2002). Du schreibst, Ich lese! – Lesen und Schreiben lernen mit Text-To-Speech-Software. In T. Fitzner (Hrsg.), Alphabetisierung und Sprachenlernen. Stuttgart: Klett Verlag.
Peschel, M. . (2002). Schriftmaschine Computer. Eine multimediale Lerneinheit im Anfangsunterricht Deutsch. In Grundschule (Bd. 01/2002). Braunschweig: Westermann Verlag.

Projekte im Fokus

Das Dachprojekt Digitale Grundschule ( bündelt und organisiert die...

Projekte im Fokus

Sprachlichkeiten – Fachlichkeiten Das Projekt „Sprachlichkeiten – Fachlichkeiten“...
Go to top